KEGG   Chryseobacterium sp. IHB B 17019: ATE47_04765Help
Entry
ATE47_04765       CDS       T04193                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cih  Chryseobacterium sp. IHB B 17019
Pathway
cih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cih01100  Metabolic pathways
cih01110  Biosynthesis of secondary metabolites
cih01130  Biosynthesis of antibiotics
cih01230  Biosynthesis of amino acids
Module
cih_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ATE47_04765
Enzymes [BR:cih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ATE47_04765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: ALR29878
Position
complement(1039788..1040561)
Genome map
AA seq 257 aa AA seqDB search
MTVLDKIIQRKKEEVAYSKAKISIELLKDSDFFERENFSLKKSINNKSGIIAEFKRQSPS
KGIINDKASPLEVASAYESFGASGISILTDKDFFGGSNKDILNVRNHVNIPILRKDFIID
EYQIYEAKSIGADVILLIASCLTSKQVQDFTELSHELGLEVLLEIHTEEELQHFNSKVDL
VGINNRNLKDFSVDLQYSVQLKNQLPKNVVSIAESGIYSIEDFNYLKEKGFDGFLMGEHF
MKNKNPAKAFEEFISNI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttagataaaattatacaaaggaaaaaagaagaagttgcctattcaaaagca
aaaatttctattgagctattaaaagattctgatttttttgaaagagaaaatttttcatta
aaaaaaagcatcaacaataaaagcggaattattgctgaatttaaaagacagtcgccttca
aaaggaataattaatgacaaagcttcccctttagaagtcgcgtcagcttatgaatctttt
ggagcaagcggaatttcaattcttactgataaagatttcttcgggggtagcaataaagat
attttaaatgtaagaaatcacgtaaatattccgattttacgaaaagatttcatcattgat
gaatatcagatttatgaagcaaaaagtatcggggcagatgttattttattgattgcgtcg
tgccttacatcgaaacaggttcaggattttacggaactttctcatgaattggggcttgag
gttttacttgaaattcatacagaagaagaacttcaacattttaattcaaaagttgatctt
gtaggaattaataacagaaatttaaaagatttcagtgttgatttacaatattccgttcaa
ttgaaaaaccaacttccaaaaaacgttgtatccattgcagaaagcgggatttacagcatt
gaagactttaattatttaaaagaaaaaggtttcgacggtttcctgatgggtgaacatttc
atgaaaaataaaaaccctgcgaaagcttttgaagaatttatttcaaatatatga

DBGET integrated database retrieval system