KEGG   Chryseobacterium sp. IHB B 17019: ATE47_08210Help
Entry
ATE47_08210       CDS       T04193                                 

Definition
(GenBank) magnesium transporter
  KO
K06195  ApaG protein
Organism
cih  Chryseobacterium sp. IHB B 17019
Brite
KEGG Orthology (KO) [BR:cih00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ATE47_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALR30514
Position
complement(1772292..1772681)
Genome map
AA seq 129 aa AA seqDB search
MMFSKMTSNIKVSVTPEYDSKNSYPSENRYVFKYNITIENDGSFAIKILKRKWLIFDVGF
GYTEIIGDGVIGLTPEIPISENFTYFSNVMLRSGVGNMSGKYLVKNMETQENFEIEIPKF
NLLSEVLSN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcaaaaatgacctcaaatatcaaagtttcagtaacacctgaatatgatagt
aagaatagttatccatctgaaaacagatatgtttttaaatacaacattacgatcgaaaat
gacggaagttttgccataaaaattcttaaaagaaaatggctgatctttgatgttggtttc
ggatatacagagattattggtgatggagtgattggcctcacgccggaaattccgataagt
gaaaattttacttatttctcaaatgtcatgcttcggtccggagtaggaaatatgagcgga
aaatatttagttaaaaatatggaaactcaggaaaattttgaaatagagatcccgaaattc
aatttgttgtcggaggttttgagtaattaa

DBGET integrated database retrieval system