KEGG   Corynebacterium imitans: CIMIT_08175Help
Entry
CIMIT_08175       CDS       T03237                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cii  Corynebacterium imitans
Pathway
cii00471  D-Glutamine and D-glutamate metabolism
cii00550  Peptidoglycan biosynthesis
cii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CIMIT_08175 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CIMIT_08175 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cii01011]
    CIMIT_08175 (murD)
Enzymes [BR:cii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CIMIT_08175 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cii01011]
 Precursor biosynthesis
  Amino acid ligase
   CIMIT_08175 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AIJ33887
UniProt: A0A076NSH3
Position
complement(1722850..1724250)
Genome map
AA seq 466 aa AA seqDB search
MATHLPVAEPVLVTGAGVSGLGAAKLLTQLGVAHAVADDNATGRANLHEMTGSPTLTTAE
AAARLGEFASVVTSPGWRPDSPLLVAAAAAGLEVIGDVELCFRLDRVGIFGAPRDWLVVT
GTNGKTTTTGMLAAIMAQVGQATGKRAQACGNIGLAVADALVAEPRVDVLVAELSSFQLY
WSSQLVPDAGVLLNLADDHLDWHGSFAGYAASKSKVLRARFAVAGIDDAHVRELAAAYQG
IIGFTQAKPREGEVGVEEERIVARLGGERVDVASATGIQPPGAAGVLDALAATAVALTQG
ATPAQIQAGLASYQVADHRGALVHAAQGVSWVDNSKATNPHAAHSALAGSEGAVVWIAGG
QLKGASVDELVREHAGQLRAVALLGQDRELIREACARLAPQLPVFVTDETDPQHAMQQVC
DYAAEQAQPGDTVLLAPAAASLDMYPGMAARGEAFRAAALRACPSD
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcaccttccggtcgccgaacccgtcctggtcaccggcgcgggcgtgtccggc
ctgggcgcggcgaagctgctcacacagctcggcgtcgcgcacgcagttgccgacgacaac
gccaccggccgtgcgaacctccacgagatgaccggctctcccacgctcactaccgctgag
gccgccgcgcgcctcggcgagttcgccagcgtggtgacttcgccgggctggcggccggac
agcccgctgctcgtagctgcagccgcggccgggctcgaggtcatcggcgacgtggagctg
tgtttccgcctcgaccgcgtcggcatcttcggtgccccgcgcgactggctggtagtcacc
ggaaccaacggcaagaccaccaccaccggcatgctcgccgcgatcatggcgcaggtaggc
caagccacggggaagcgggcgcaggcctgcggcaacatcgggctggcggtcgcggacgcg
ctggtcgccgaaccgcgcgtggacgtactcgtcgcggagctgtccagcttccagctgtat
tggtcgagccaacttgtgcccgacgcgggtgtgctgctcaacctggctgatgatcacctt
gattggcatgggtcgtttgcgggctacgcggcgtcgaaaagcaaagtgcttcgcgcacga
ttcgcggtggccggcatcgacgatgcgcacgtgcgcgagctagccgcggcctatcaaggc
atcatcggttttacccaggcgaaacctcgcgagggcgaggtcggcgtcgaggaagagcgg
atcgtcgctcgcctcggcggggagcgtgtcgacgtcgcctccgccacaggcatccagcca
cccggtgcggcgggcgtactcgacgcgctggcggcaacggctgtcgcactgacccagggc
gcaacgcctgcgcagattcaggcgggacttgcctcgtaccaggtggcggaccaccgcggc
gcgctcgtgcatgccgcacaaggcgtgagctgggtggataactcgaaggcgacgaacccg
cacgcggcgcactccgcgctcgcgggcagcgaaggtgcagtcgtgtggatcgccggcggc
cagctcaagggcgccagcgtggacgaactcgtgcgcgagcacgccgggcagttgcgcgcc
gtcgcgctgctcggccaggaccgggagctcatccgcgaggcctgcgcgcggcttgccccg
cagctcccagtcttcgtcacggacgagacggatccgcagcacgcgatgcagcaggtctgc
gactacgcggccgagcaggcacagccgggcgacacggtcctgctggccccggcggcggcg
agcctggacatgtacccgggcatggctgcccgcggtgaggccttccgcgcggcggcgctg
cgcgcgtgcccatcggattga

DBGET integrated database retrieval system