KEGG   Corynebacterium imitans: CIMIT_09925Help
Entry
CIMIT_09925       CDS       T03237                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cii  Corynebacterium imitans
Pathway
cii00020  Citrate cycle (TCA cycle)
cii00620  Pyruvate metabolism
cii00650  Butanoate metabolism
cii01100  Metabolic pathways
cii01110  Biosynthesis of secondary metabolites
cii01120  Microbial metabolism in diverse environments
cii01130  Biosynthesis of antibiotics
cii01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIMIT_09925
   00620 Pyruvate metabolism
    CIMIT_09925
   00650 Butanoate metabolism
    CIMIT_09925
Enzymes [BR:cii01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CIMIT_09925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans Phage_rep_org_N
Motif
Other DBs
NCBI-ProteinID: AIJ34162
UniProt: A0A076NTF6
Position
complement(2070754..2072262)
Genome map
AA seq 502 aa AA seqDB search
MGNRIANAKLRDKVMSAEEAVQFVNHGDKVGVSGFTGAGYPKALPGVIAEKAKAAHAKGQ
DFSIDLYTGASTAPECDGVLAEANALRYRMPYQSDPQMRNKINAGEMKFQDIHLSHSGMM
VEQGFFGDVDLAIVEAVRITEEGNIVPSSSVGNSVEFLNAAKKIIIEVNEWQSEDLEGMH
DIWTVPALPNRIPIPITKSGDRIGTTYIEIDPEKVVAVVETNAPDRNAPFKAPDEVSEQI
AGNFLDFLENEVKAGRLTYDGYVMQSGVGNVPNAVMAGLMDSKFENIQAYTEVIQDGMVD
LIDAGKMTVASATSFSLSPEYAEKMNDEAARYRESIILRPQSISNHPEVIRRTGLIASNG
MIEADIYGNANSTHINGSRLMNALGGSGDFTRNAYISSFISPSVAKDGAISAIVPMVSHV
DHTEHDAMVFITEYGVADLRGLAPRDRVQKMISIAHPSYRPLLEEYVELASKSKYQATPH
DLRHAFDFHTRIQETGTMQKEG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaccgtatcgccaatgcaaaactgcgtgacaaggtcatgtccgctgaagaagcg
gtccagtttgtcaaccatggcgacaaggtgggcgtgtccggctttaccggggctgggtac
cccaaggccctgccgggcgtcatcgcagaaaaggccaaggctgcgcacgccaagggccag
gacttcagcatcgacctctacacgggtgcatccaccgcgccggagtgcgacggtgtgctc
gcagaggccaacgcgctgcgctaccgcatgccgtaccagtccgacccgcagatgcgtaac
aagatcaacgctggcgagatgaagttccaggacatccacctgtcccactcgggcatgatg
gtggagcagggcttcttcggtgacgttgacctggccatcgtggaggcagtccgcattact
gaggagggcaacattgtcccgtcctcctccgtgggcaactctgtcgagttcctcaacgcc
gccaagaagatcatcatcgaggtcaacgagtggcagtccgaggacctggaaggcatgcac
gacatctggaccgtgccggcgctgccgaaccgtatcccgatcccgatcaccaagtccggc
gaccgcatcggtaccacctacattgagattgacccggagaaggtcgtcgctgtcgtcgag
accaatgccccggaccgcaacgcaccgttcaaggccccggacgaggtgtcggagcagatc
gctggcaacttcctcgacttcctggagaacgaggtcaaggccggccgtctcacctacgac
ggctacgtcatgcagtccggcgtgggcaacgtcccgaacgcagtgatggcgggcctgatg
gactccaagtttgagaacatccaggcctacaccgaggttattcaggacggcatggtcgac
ctgattgacgcgggcaagatgaccgtcgcttccgcgacctccttctccctgtccccggag
tacgcagagaagatgaacgatgaggctgcgcgctaccgcgagtccatcatcctgcgcccg
cagtccatctccaaccacccggaggttatccgccgcaccggcctgatcgcctccaacggc
atgatcgaggcggacatctacggtaacgccaactccacgcacatcaacggctcccgcctg
atgaacgcgctgggtggctccggtgacttcacccgcaacgcgtacatctcctccttcatc
tccccgtcggtggccaaggacggcgcaatttccgcgattgtcccgatggtctcgcacgtg
gatcacacggagcacgacgcgatggtcttcattaccgagtacggcgtggcagacctgcgc
ggcctggcaccgcgtgatcgtgttcagaagatgatctcgatcgctcacccctcctaccgt
ccgctgctggaggagtacgtcgagctggcgtcgaagagcaagtaccaggcgaccccgcac
gacctgcgccacgccttcgacttccacacccgcatccaggagacgggcacgatgcagaag
gagggctaa

DBGET integrated database retrieval system