KEGG   Corynebacterium imitans: CIMIT_11080Help
Entry
CIMIT_11080       CDS       T03237                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cii  Corynebacterium imitans
Pathway
cii00071  Fatty acid degradation
cii00072  Synthesis and degradation of ketone bodies
cii00280  Valine, leucine and isoleucine degradation
cii00310  Lysine degradation
cii00362  Benzoate degradation
cii00380  Tryptophan metabolism
cii00620  Pyruvate metabolism
cii00630  Glyoxylate and dicarboxylate metabolism
cii00640  Propanoate metabolism
cii00650  Butanoate metabolism
cii00900  Terpenoid backbone biosynthesis
cii01100  Metabolic pathways
cii01110  Biosynthesis of secondary metabolites
cii01120  Microbial metabolism in diverse environments
cii01130  Biosynthesis of antibiotics
cii01200  Carbon metabolism
cii01212  Fatty acid metabolism
cii02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CIMIT_11080
   00630 Glyoxylate and dicarboxylate metabolism
    CIMIT_11080
   00640 Propanoate metabolism
    CIMIT_11080
   00650 Butanoate metabolism
    CIMIT_11080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CIMIT_11080
   00072 Synthesis and degradation of ketone bodies
    CIMIT_11080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CIMIT_11080
   00310 Lysine degradation
    CIMIT_11080
   00380 Tryptophan metabolism
    CIMIT_11080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CIMIT_11080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CIMIT_11080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CIMIT_11080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cii04147]
    CIMIT_11080
Enzymes [BR:cii01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CIMIT_11080
Exosome [BR:cii04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMIT_11080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Death ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIJ34352
UniProt: A0A076NTX4
Position
2327817..2329034
Genome map
AA seq 405 aa AA seqDB search
MNQPEIVICNPKRTAVGRYGGAFVGVPVQELAATVVTEVIKEAGIEGSLIDDIILGQASP
NGAAPALGRVVALDAELGVDVPGMQLDRRCGSGLQAVATAAAHIASGAADLIIAGGAESM
SNTEYTVDGKIRWGAKGGNLEFKDRLQEGREQAGGKHHPIPGGMIETAENLRDEYSIARD
RQDQLAVNSHKRAAAAQEAGKFDEEIVPVSVPQRKGDPIVVDKDEHIRPNTSTESLAKLR
PVMGKKLDGATVTAGNASGQNDGAAAMIVTTREKAEELGLNPAAVLRGWAVAGVAPETMG
IGPVAATEKLFDRLGISFDDIDLIELNEAFAAQALAVLDAWGISEDDPRVNPVGSGISLG
HPVGATGARMLVTASHEMQRTDAKRALVTMCIGGGQGLAAVIEKA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccagagatcgtcatttgcaacccgaagcgcaccgcagtcggccgctacggc
ggcgcgtttgtcggcgtgcctgtccaagagctcgccgcgaccgtcgtcaccgaggtgatc
aaggaggcgggcatcgaaggctcgcttatcgacgacatcatcctcggccaggcctccccc
aacggtgccgcgcctgccctgggccgcgtggtcgcccttgacgcggagctgggcgtagac
gtccccggcatgcagctggaccgccgttgcggctccggcctgcaggcagtggccactgcc
gcagcccacatcgcctccggcgcggccgacctgatcattgccggcggcgccgagtccatg
tcgaacaccgagtacacggtggacggcaagatccgctggggtgccaagggcggcaacctc
gagttcaaggaccgcctgcaggagggccgcgagcaggccggcggcaagcaccacccgatc
ccgggcggcatgatcgagaccgccgagaacctgcgcgatgaatactccattgcccgcgac
cgccaggaccagctcgccgtgaactcccacaagcgcgccgccgcagcccaggaggccggc
aagttcgacgaggagatcgtccccgtttccgtcccgcagcgcaagggcgacccgatcgtg
gtggacaaagacgagcacatccgcccgaacacctccaccgagtccctggccaagctgcgc
ccggtcatgggtaagaagctggacggtgccaccgtgaccgccggcaacgcctccggccag
aacgacggtgccgccgccatgatcgtgaccacccgcgagaaggccgaagagctgggcctg
aacccggctgccgtcctgcgcggctgggccgtcgccggcgtggccccggagaccatgggt
atcggcccggtcgccgcgaccgagaagctctttgaccgcctcggcatctccttcgacgac
atcgacctgatcgagctcaacgaggccttcgccgcccaggccttggcggtgctggacgcc
tggggcatttccgaggacgacccacgcgtcaacccggtcggctccggcatctcgctcggc
caccccgtcggtgccaccggcgcccgcatgctggtcaccgcctcccacgaaatgcagcgc
accgacgccaagcgcgccctggtgaccatgtgcatcggcggcggccagggcttggccgcg
gtgattgagaaggcgtaa

DBGET integrated database retrieval system