KEGG   Citromicrobium sp. JL477: WG74_03125Help
Entry
WG74_03125        CDS       T04089                                 

Definition
(GenBank) divalent cation transporter
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
cij  Citromicrobium sp. JL477
Brite
KEGG Orthology (KO) [BR:cij00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    WG74_03125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-ProteinID: ALG59957
Position
complement(631155..631466)
Genome map
AA seq 103 aa AA seqDB search
MSALIYTVFATREDARAVASQLLDERLIACANVIGRIKSLFEWDGERGEGEEIAILFKTN
AERLDDAVARLETLHQYEAPAILGWRADSAGKATTAWLAALGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgctgatatacaccgtgttcgccactcgagaggacgcccgcgcggtcgcctcg
caactgctggacgagcggctgattgcctgtgccaatgtgatcggccggatcaagtcgctg
ttcgaatgggatggcgagcgcggcgagggcgaggagatcgcgatcctgttcaagaccaat
gccgagcggctggacgatgccgtcgcgcgtctggaaacgctgcaccaatatgaagcgccc
gccattctcggttggcgcgcggacagcgctggcaaggccacgacggcctggctggcggcg
ctgggcggttag

DBGET integrated database retrieval system