KEGG   Citromicrobium sp. JL477: WG74_05120Help
Entry
WG74_05120        CDS       T04089                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00860  Porphyrin and chlorophyll metabolism
cij01100  Metabolic pathways
cij01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cij00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WG74_05120
Enzymes [BR:cij01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     WG74_05120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red DUF4567
Motif
Other DBs
NCBI-ProteinID: ALG60301
Position
1012580..1014175
Genome map
AA seq 531 aa AA seqDB search
MQLSVWTYEGPPHVGAMRVATAMRGVHYLLHAPQGDTYADLLFTMIERRNARPPVTYTTF
QARDLGKDTADLFQRAARDAYARFDPQVMLVGSSCTAELIQDDPAGMAEAMRLPCPVVPL
ELPSYSRKENWGAGETFYQIVRHLADRDVRPTARDGRKPLVNILGPAALGFRHRDDVREV
RGILNRLGIDVNCVAPLGASPADIARIGAADFNIVLYPEIGDSAARWLEREFKQPRTKTV
PLGVGATREFIAEVAALAGVDPEPARADGESRMPWWSRSVDSTYLTGKRVFVFGDATHAV
AAARVAHEELGFKVVGLGCYNREFAREVRDAARAYGVEPLITDDHLEVEDAIAAAAPELV
LGTQMERHIAKRQGVPCAVISAPVHVQDFPARHSPQMGFEGANVLFDTWAHPLVMGLEEH
LLTMFREDFEFSDDAGASHLAAHSPSRHAEPVSASSAPTAPTFQEEDWTPGQVRGDDEDT
LWTAEAEAELKKIPFFVRGKAKRNTETYASEQGRAAIDLETLYDAKAHYAR
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgtctgtctggacctacgagggacctcctcatgtcggcgcgatgcgggtcgcg
acagcgatgcgcggagtccactacctgctccacgcaccgcagggcgatacttatgcggat
ctgctattcacgatgatcgagcggcgcaatgcccgcccgccggtcacctacaccaccttc
caggcgcgcgatctgggcaaggataccgccgacctgttccagcgcgcggcgcgcgatgcc
tatgcgcggttcgacccgcaggtgatgctggtcggatcgtcatgcaccgccgagctgatt
caggacgatccggcgggaatggccgaggcgatgcgcctgccgtgcccggtcgtcccgctc
gaactgccgagctattcacgcaaggaaaactggggcgcgggtgagaccttctaccagatc
gtgcgccatctggcggaccgagatgtgcgtccgacggcgcgtgatggccgtaagccgctg
gtcaacattctcggcccagcagcactgggctttcgccaccgcgacgatgtgcgcgaagtg
cgcggtatcctcaaccggctcggtatcgacgtgaactgtgtcgcaccgctgggcgcttcg
cccgccgacatcgcccggatcggtgcggcggacttcaacatcgtgctctatcccgaaatc
ggcgacagcgccgcccgctggctggaacgcgagttcaagcagccacgcaccaagaccgta
cccctaggcgttggcgcaacccgcgagttcattgccgaggtcgccgcgctggcgggcgtc
gatcccgaacccgcacgggccgacggcgagtcgcgcatgccgtggtggagccgctcggtc
gattcgacctacctgacgggcaagcgcgtgttcgtgttcggcgatgccacccacgcggtt
gctgctgcgcgggtcgcgcacgaagagctgggtttcaaggtggtcgggctcggctgctac
aaccgcgaattcgcccgcgaggtacgcgatgcggcgcgagcttatggcgtcgaacctttg
atcaccgacgaccatctcgaggtcgaggacgcgatcgccgccgccgcgcccgagctggtg
ctgggcacgcagatggaacgtcacattgccaagcggcaaggcgtgccctgcgcggtgatc
tcggccccggtgcacgtgcaggacttccccgcgcgccacagcccgcagatgggtttcgag
ggcgcgaacgtgctgttcgacacttgggcgcacccgctggtcatggggctggaagagcac
ctgctgaccatgttccgcgaggatttcgaattctccgacgatgctggggcctcgcatctg
gccgcccattcgccatctcgtcatgctgaacctgtttcagcatccagtgcgccaacggct
ccgaccttccaggaggaggactggaccccgggacaagttcggggtgacgatgaagatacg
ctctggaccgccgaggccgaggcggagctgaagaagatccccttcttcgtacgcggcaag
gcaaagcggaacacggaaacctacgcgtccgaacagggccgcgccgcaatcgacctcgaa
acgctgtacgacgcgaaggcgcattatgcccgctag

DBGET integrated database retrieval system