KEGG   Citromicrobium sp. JL477: WG74_05130Help
Entry
WG74_05130        CDS       T04089                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide oxidoreductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00860  Porphyrin and chlorophyll metabolism
cij01100  Metabolic pathways
cij01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cij00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WG74_05130 (chlL)
Enzymes [BR:cij01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     WG74_05130 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 AAA_16 NB-ARC SRP54 AAA_25 CBP_BcsQ RNA_helicase DUF87
Motif
Other DBs
NCBI-ProteinID: ALG60303
Position
1017718..1018605
Genome map
AA seq 295 aa AA seqDB search
MLDAATQAPPDGDGSVQVQLDPSDKIKGAKVFAVYGKGGIGKSTTSSNLSAAFSKLGHRV
LQIGCDPKHDSTFTLTKKLMPTVIDALEQVEFHSEELRTEDFMFEGYNGVMCVEAGGPPA
GTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGFAAPLQHAERALVVAANDFD
SIFAMNRIVAAIGAKAKNYDVRLAGVVANRSRETDEIDRFCDEIGMQRLAHFQDLDAIRR
SRLKKCTLFEMEECPEVLAAQLEYIRLAQLLWDGVDPSEATAMKDRDIFDFLGFE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgccgcgacacaggcaccgccggatggcgacggttcagtccaggtccagctc
gacccgagcgacaagatcaagggcgcgaaggtcttcgcggtctacggcaagggtgggatc
ggcaagtcgacgacctcgtccaacctctccgccgcgttttccaagctcggccaccgggtg
ctgcagatcggctgcgatcccaagcacgacagcaccttcacgctaaccaagaagctgatg
ccgacggtgatcgatgcgctggagcaggtcgagttccacagcgaggaactgcggaccgag
gacttcatgttcgaaggatacaacggcgtgatgtgcgtcgaggcgggcgggccgcctgcg
ggcacgggctgcggcggctatgtggtcgggcagacggtgaagctgctgaaacagcaccac
ctgctcgaagacaccgacgtcgtcatcttcgacgtgctgggcgacgtggtgtgcggcggg
ttcgccgcgccgctgcaacatgccgagcgtgcgctggtggtagccgccaacgatttcgac
agcatcttcgcgatgaaccggatcgtcgccgcgatcggcgcgaaggccaagaactacgat
gttcgcctcgccggggtggtcgccaatcgtagccgcgagaccgacgagatcgaccgcttc
tgcgacgagatcgggatgcagcggctggcgcattttcaggatctcgacgcgatccgccgc
agccgcctgaagaagtgcactttgttcgagatggaggagtgccccgaggtgctcgccgcg
cagctcgaatatatccgtctcgcgcaactgctgtgggatggggtcgacccttccgaagcg
accgcgatgaaggaccgcgatatcttcgattttctggggttcgagtaa

DBGET integrated database retrieval system