KEGG   Citromicrobium sp. JL477: WG74_07820Help
Entry
WG74_07820        CDS       T04089                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cij  Citromicrobium sp. JL477
Pathway
cij00230  Purine metabolism
cij00250  Alanine, aspartate and glutamate metabolism
cij01100  Metabolic pathways
Module
cij_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cij00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    WG74_07820
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WG74_07820
Enzymes [BR:cij01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     WG74_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ALG60741
Position
1638864..1640153
Genome map
AA seq 429 aa AA seqDB search
MANVTVIGAQWGDEGKGKIVDWLASRADAVVRFQGGHNAGHTLVVDGTTYKISLVPSGIV
TGTLSLIGNGVVLDPWALKSEIEKLEGQGVKITADNFAVADNCPLILPLHRDLDGLRETA
AGQGKIGTTGRGIGPAYEDKVGRRAIRVCDLAHLDEIEPQLDRLCAHHDALRAGFDEPPI
DREQLISELREIAPFVLQFAQPVWKRLKKVRKAGARILFEGAQGVLLDVDHGTYPFVTSS
NTVSGTAASGSGLGPNATGFVLGITKAYTTRVGSGPFPTELEDEIGQGLGERGHEFGVVT
GRKRRVGWFDAVLVRQTCAISGVTGIALTKIDVLDGMDKVKICTGYRIDGKIYDYLPSHA
ASQARCEPIYEEMEGWQESTAGARSWADLPANAIKYISRIQELIECPVALVSTSPEREDT
ILVRDPFED
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggccaacgtaaccgtgatcggggcccagtggggtgacgagggcaagggcaagatcgtc
gactggctggcgagccgcgccgatgccgtcgtccgcttccagggtggccacaatgccggc
catacgctggtggtcgacggcacgacctacaagatcagtctggtgccctctggcatcgtg
accggcacgctctcgctgatcggcaatggcgtggtgctcgacccgtgggcattgaagtcg
gagatcgagaagctcgaagggcagggggtgaagatcaccgccgacaacttcgccgtcgcc
gacaactgcccgctgatcctgccgctccatcgcgacctcgacggcctgcgcgaaaccgca
gcggggcagggcaagatcggtaccaccgggcgcggcatcggcccggcttacgaagacaag
gtcggccgccgcgcgatccgcgtgtgcgacctcgcgcatctcgacgagatcgagccgcag
ctcgaccgtctctgcgcgcaccatgacgcgctgcgcgcgggcttcgacgagccgccgatc
gaccgcgaacaactgatttcagagctgcgcgagattgcacccttcgtgctgcaattcgcg
cagccggtgtggaagcggctgaagaaggtccgcaaagcgggcgcgcggatcctgttcgaa
ggcgcgcagggcgtgctgctcgatgtcgatcacggtacctatcccttcgttaccagctcc
aacacggtcagcgggacggcggcgagcggttcgggcctcggccccaatgcgaccggtttc
gtcctcgggatcaccaaggcctacaccacccgcgtgggcagcgggcctttcccgaccgag
ctggaagacgagatcggccaggggctgggcgagcgcgggcacgagttcggcgtggtcacg
gggcgcaagcggcgcgtcggctggttcgacgcggtgctggtgcgccagacctgcgcgatc
agcggggtgacgggcatcgcgctgaccaagatcgacgtgctcgacgggatggacaaggtg
aagatctgcaccggctatcgtatcgacggcaagatctacgactacctgccgagccacgcg
gcgagccaggcgcggtgcgagccgatctacgaagagatggaaggctggcaggaaagcacc
gccggggcgcgtagctgggccgatttgcccgccaacgcgatcaagtatatcagccgcatc
caggaactgatcgagtgccccgtggcgctggtttcgaccagcccggagcgtgaggacacg
atcttggtccgcgatccgttcgaagactag

DBGET integrated database retrieval system