KEGG   Coccidioides immitis: CIMG_00954Help
Entry
CIMG_00954        CDS       T01114                                 

Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cim  Coccidioides immitis
Pathway
cim00330  Arginine and proline metabolism
cim00332  Carbapenem biosynthesis
cim01100  Metabolic pathways
cim01130  Biosynthesis of antibiotics
cim01230  Biosynthesis of amino acids
Module
cim_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CIMG_00954
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CIMG_00954
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CIMG_00954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA Nucleotid_trans
Motif
Other DBs
NCBI-GeneID: 4566976
NCBI-ProteinID: XP_001247183
UniProt: J3KI38
AA seq 444 aa AA seqDB search
MKGTSKALTIVIKLGTSSIVDEHTREPILSILTLIVEMATKLHKDGHRVIIVSSGAVGVG
LRKMDIEQRPKHLPCIQALAAVGQCQLMGIWDSLFAHLRQPIAQILLTRNDIADRTQYIN
AQNTFDELLKMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVQADYLFLLTDVDGLYT
SNPRTNPDAEVIEVVDDISSLEADVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITRSS
RPGNISEIIDYLESSKRSLALIEGEPMAQPPLYTPPLHTRFLPSTTPMQSRSFWILHGIT
PHGTIYIDHGAYCAILNNASLLPAGVVAVEGHFSQQEAVRVVVVERRSPSALNGDFPLNG
EEPKEAGRALVNYGSAEIARIKGLRSTQIRTVLGYADSEYIALRENISFFHMSDRPSRPG
TPGLDEFMVRSGAQSPVIDKVVAA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctcgaaggcattgaccattgtgataaagctcgggacgagttcaattgtg
gatgagcatacccgtgagccgattctttcgatccttactctgatcgtggagatggcgacc
aaacttcataaagatggccatcgagtcattatcgtctcgtctggagcggtcggcgttggg
ctacgcaaaatggacattgagcagagaccaaaacacttgccctgtattcaggctttggct
gctgttggacagtgccagttgatgggtatatgggatagtcttttcgctcatcttcgccag
cccattgcccaaatattgttgacaagaaacgatattgcggataggacccaatatattaat
gctcaaaatacctttgatgaattgctaaaaatgggcgtgattcctattgtgaacgagaat
gatacccttgctgtttcggaaataaaatttggagataacgataccctttctgcgattaca
gctgcgatggtccaagcggattacttattccttttgactgatgtcgatggcctatacact
tctaacccgcgaaccaaccccgatgccgaggttatcgaagtggttgatgatatctcgtct
cttgaagctgacgtttcgacagccggatcctccttaggcacggggggaatgagcaccaaa
attgtggcagcccgactagctacaagtgcaggtgtcacaaccgtcattacacgcagttct
cggcctggaaacatttcggagattatagattacctcgaaagctccaagcgctcgctggcc
cttatcgaaggagagccgatggctcagcctcccctatatacccctccgttacacacccgt
ttcctcccttcgaccactccgatgcaatccagatcgttctggattctccatggaatcaca
cctcatggcacaatatatatcgaccatggtgcttactgcgctattttaaacaacgcaagc
cttcttccggccggcgtcgtggcagtcgaggggcacttctcccaacaggaagcggtgcgg
gtcgtagtcgtcgagcggcgctccccatcggctctcaatggggatttccctctgaacggc
gaggagccaaaggaagccggacgagcgctcgtaaattacggcagtgcggagatcgcccgt
ataaaggggttaagaagtacacaaatacggacagttttgggctacgcagatagcgagtac
attgcgttgcgcgagaatatttcctttttccacatgtcagatcgacctagtcggcccggt
acgcccggtttggatgagttcatggttcgaagcggcgcgcagtctcctgtgatcgataag
gtagtggcagcctag

DBGET integrated database retrieval system