KEGG   Coccidioides immitis: CIMG_00992Help
Entry
CIMG_00992        CDS       T01114                                 

Definition
(RefSeq) PHD finger and JmjC domain-containing protein
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cim04121]
    CIMG_00992
   03036 Chromosome and associated proteins [BR:cim03036]
    CIMG_00992
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     CIMG_00992
Ubiquitin system [BR:cim04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     CIMG_00992
Chromosome and associated proteins [BR:cim03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    CIMG_00992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JHD PHD Cupin_8 PHD_2
Motif
Other DBs
NCBI-GeneID: 4565515
NCBI-ProteinID: XP_001247221
UniProt: J3KI66
AA seq 1402 aa AA seqDB search
MAASMSFRRPSNSRPPQYRTPSPPRYAVEPLSPHASAASYRPPWDIGASGSEKVPTPLQH
CQPQAANNFDASRGNNSHPDPPAETKSLGRLGHSRTGSNIDTLATIALATRARFGPLTYS
SAPDNESRERPSKRARSERSPSPAWQTFGARPATSHTSSFDSMKTDAELLLNFARPANFP
PRQPIQPAPQFHNSGPEASNMESKWNIPPPTVPDESFNISSNKVSAAFFGGSGALARVRS
RSDGAAALSRPTINGYNSGSPKGPPPMGPVLEDESNGPEEQGERATVTVEEKAESRPPKR
GPKSKGRRRQSDTAVKSEDADSDSSNQTNCAACSLVRVPMNNGDDAEVTWVNCDGCNRWF
HIVCAGFKNDREIRTVDKFICKECRPVHGPTTFVRKSSRPKTSIDYAGLNQGFVKPSTEA
PDHHYIQPIKAGKMTFLPDHFARLPAEFVTAEYFEHGIGMPEPVVIPAHLNPRTPASALG
LENYCPQFKEASSQEEFDAIIDSLPNDDDSEEVIDCCQDLLDMVIPNNLTVRTVGELYGL
DERVEVIDVKSQQGEDKRWNMRKWVDYYHDSSASKTVRNVISLEVSQSPLGKLIRRPKIV
RDLDLQDAVWPNELKEIGDYPKVQFYCLMSVADCYTDFHVDFGGSSVYYHIIKGKKTFFF
IPPKEKHLKKYEEWCNSTAQDTTFLADQTKECYRVDLSEGDTMLIPSGWIHAVWTPEDSL
VIGGNFLTRMNYGMQIKIAQIEKDTKVPRKFRYPFFQKIMWYTAFKYLDEDPVPQNVLDS
FARDENYRFYREYPLYYQFGEHASKAETGSDYYNSRFYSQAELDGLPDLAKYLLRTALIA
GGYMVDGVTKETRNAVSRSIPKGQGDPIETVVKFGIWVAWKRGNEPAAQWTRPGAISLDA
KVDISDKRRTARPTRRSERNASNGTRRASMASETSKPMQGQNLDDRVSIAPSTSNKGSPT
PAKRKVSFPDIKLEQDSMPKPVSKGTNLGPKRVACDACRKRRIRCRHKAEHNGDVVSGNQ
HISFQSNGEQVRRASEILPNSTINTSTDEDISINYAESAQGSASGPVPPETTLNYSAGAS
GNSPNSSNSAKKGRNKACDECRKSKRRCIHDESGKVDPVKAQERAKPRTGITKRPRSSDG
YSSVSKRPRLSQSIHERPEKGEEFGAVPTVASHLNLERIDNPADHIHPRHELSNASEPAT
NGKAQDKGLYTSPAVNTELDGPSRPEGELRPAPPTDSLVSPPTSLLDGRDEIVNNPEQTL
PIVNDNAKEYPVDVNTPASTSPKTPHPTVREISPPRREEYESLKVAVPDSAKDQVISTPV
ITSKPTKPSSRPSSSHKSKQFMAKEVKQAHPAAERKGSPSHMRHNASLTSPQNQFRPGKR
DRNKSSDSVNGRRGPKFRYFSF
NT seq 4209 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctctatgtcgtttcgcaggccctccaatagccgacctcctcagtaccgtact
ccttccccgccgagatacgctgtcgagcctctctccccccacgcatccgccgccagctat
cgcccgccgtgggatatcggtgcgagcggctctgaaaaggtgccaacgcctttacaacat
tgccagccacaagcagcgaataactttgacgcctctcgggggaacaacagccatccagac
ccccctgctgagaccaaatctctcggcagattggggcattcaagaaccggctcgaatatc
gacacgctagccaccattgctctcgccacgagggctagatttggaccgctgacctacagt
tctgctcccgacaatgagtcaagagagagaccttcgaaacgagcaaggtcggagcggtca
ccatcgccagcctggcaaacatttggtgctaggcccgcgaccagccatacttcgtccttt
gatagcatgaagactgacgcagagctccttctaaacttcgcaaggccggctaacttcccc
ccacgacagccgatccaaccggcccctcaattccacaacagtgggccggaggctagcaac
atggagtcgaagtggaatataccaccccccaccgtccctgacgagtcgttcaatatctca
agcaacaaagtctctgcagcatttttcggtggctcgggtgccttggctcgagtacgatcc
aggtccgatggcgcggcggccctttcccgacctacgattaacggatacaactctgggtct
cccaaagggccaccgccgatgggtccggttctggaagatgagtcaaacggcccggaagag
caaggagagcgagctactgtgactgttgaagagaaggccgaatcacgtccaccaaaacgg
ggcccgaagtccaaaggtcgccgtcgccagtcagacactgccgtgaaaagcgaagacgct
gacagtgactcgtcaaaccaaacaaattgcgctgcatgcagtttagtccgagtgcctatg
aacaatggcgatgatgccgaagttacttgggtcaactgtgacggctgtaataggtggttc
cacattgtttgtgccggattcaaaaacgaccgtgaaattcggaccgtggataagttcata
tgcaaagaatgccgaccggtacatgggccgacaacttttgtgcgcaagtcttcgcgacca
aaaacatctattgactacgctgggctgaatcaaggtttcgtaaagccgtcaacagaagcc
ccagatcaccattatattcagcccattaaagcggggaagatgacatttttgcctgatcat
ttcgctcgcctccctgcggaattcgtgactgcagaatatttcgaacatggtatagggatg
ccagagcctgtcgttattcccgctcatctaaatcctcgtactcctgcctctgcacttggc
ttggaaaattactgtccacagttcaaagaagcgtcaagtcaagaagaattcgatgccatt
atcgatagtcttcccaacgacgacgatagtgaagaagtgatcgattgttgccaggatctt
ctcgatatggtcatcccaaataacctcacggttcgaacggtgggtgaactttacggcctg
gatgagcgagtagaggttatcgatgtcaaatctcagcagggcgaagataagagatggaac
atgcgaaaatgggtggactattaccatgacagcagcgcatcgaagactgtcagaaacgtt
atcagccttgaggtgtcgcagagtcccctcggaaaactaatccgtcgccccaagatagtt
cgtgacctggatctacaagatgcggtttggcccaatgaactgaaagaaattggcgactac
ccgaaagtgcagttctactgtttaatgtccgtggcagattgttacaccgacttccacgtg
gactttgggggatcgtcggtttactatcatatcattaaggggaagaaaacatttttcttt
atccctcccaaggaaaagcatctaaaaaaatatgaggaatggtgcaattctaccgcacaa
gataccacctttcttgcagaccagaccaaagaatgctatcgcgttgacttgtcagaaggt
gataccatgcttatcccatctggttggatccatgcggtatggacgccggaagatagtctc
gtcatcggtggtaactttctcaccagaatgaactatggaatgcaaatcaagattgcgcag
atcgaaaaggatacgaaagttccaagaaagttccggtaccctttcttccagaagattatg
tggtacaccgcgtttaagtatctcgacgaagaccccgttcctcaaaacgtactggattct
tttgctagggatgaaaactaccgattttatcgcgaatatcccctctattaccaatttgga
gaacacgcaagtaaagcagaaacaggctcagattattacaactcccgtttttattcgcaa
gcggaactcgacggtctcccggacctcgccaaatacttattgagaactgctctaattgca
ggtggatatatggtggatggcgtaacgaaggaaacaagaaatgccgtgagtcgatccatc
ccaaagggccaaggcgatcctatcgagacggtcgtaaaatttggaatatgggttgcatgg
aagaggggtaatgagcctgctgctcagtggactcgcccaggagcaatatctcttgatgcg
aaggtcgatatttctgataaaagacgaacggcacgtccgactaggcgttcggaaaggaat
gccagcaatggtacccgccgagctagcatggcttcagaaacatccaagccgatgcagggt
cagaatctggacgatagagtatcaatcgccccatccacttcgaataaaggcagtccgact
ccggcaaagcgaaaagtgtcgttcccggacatcaaactcgagcaggacagtatgccaaaa
ccggtctccaagggtactaaccttggtccaaaaagagtggcctgtgacgcatgtcgaaag
cgccgtattcgttgtcgccataaagctgaacataacggcgatgtggtttcaggcaaccaa
catataagtttccaatcaaacggcgaacaggttcgaagagcctcggagattcttccgaat
agtactatcaacacatcaactgacgaggatatttcgattaactatgcggagtcggcccag
ggtagcgcttctggtccggtgccaccagagacgacccttaattattcagctggggccagt
ggaaacagcccaaactcctcaaattctgctaaaaaagggagaaacaaggcttgtgatgag
tgcagaaagagcaagcgccgttgcatccatgatgaatccggaaaggtggatcctgttaaa
gcccaagaacgagcaaaaccgcgaaccggaattacaaagcgtccacgttccagcgatggt
tactcgtcagtatccaaaaggcccagactcagccagagtatacacgagcgcccagagaaa
ggtgaagaattcggcgctgtgcctacggtggcttctcacctgaatctggagcgaatagat
aacccagctgaccacatacatccgagacacgagttgagcaacgcgtcagaaccggcgaca
aatggaaaggctcaggataaagggttgtatacatctccagctgtgaacactgaactagat
gggccatctcgtcctgaaggcgagctaagacctgctccacctactgacagccttgtgtcg
ccaccaacgtcccttcttgatggccgtgacgagatcgtcaacaatccagagcaaaccttg
cctattgtgaatgataacgctaaggaatacccagttgatgttaacactccggcttcgacg
tcgcccaaaacaccccacccaacggtacgggaaatttctcctccacgccgagaagagtat
gaaagcctgaaagttgctgtaccagattcagcgaaagatcaagtcatttcaacgccagtg
atcacttcaaaacccacaaagccatcttctcgaccgtcctcctcacataaatcgaagcaa
ttcatggccaaggaagtcaaacaagcccatcctgcagctgagagaaagggatctccgagc
catatgcggcacaatgcaagccttacatccccgcaaaatcagtttagaccgggcaaacgt
gatcgtaacaagagttcggactccgtaaacggtcgacgagggcctaaatttcgatatttt
tccttctga

DBGET integrated database retrieval system