KEGG   Coccidioides immitis: CIMG_01115Help
Entry
CIMG_01115        CDS       T01114                                 

Definition
(RefSeq) thiamine thiazole synthase
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
cim  Coccidioides immitis
Pathway
cim00730  Thiamine metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CIMG_01115
Enzymes [BR:cim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     CIMG_01115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl NAD_binding_9 Pyr_redox_2 FAD_binding_2 FAD_binding_3 Pyr_redox_3 FAD_oxidored Trp_halogenase HI0933_like
Motif
Other DBs
NCBI-GeneID: 4566820
NCBI-ProteinID: XP_004445834
UniProt: J0HE72
AA seq 328 aa AA seqDB search
MSTVTETVTLPTHLANKTELVGHPPTVNSKEAGDRALLDEFAGKWDSFKFGPIRESQVSR
AMTRRYFKDLDTYAESDIVIVGAGSCGLSTAYVLAKARPDLKIAIIEAAVSPGGGAWLGG
QLFSAMVLRKPADKFLDEIGVPYEEEPSNPHVVVIKHASLFTSTLLSKVLAFPNIKLFNA
TCVEDLITRPEPAGGLRIAGVVTNWTLVAEHHDDHSCMDPNTINTPLVISTTGHDGPFGA
FCAKRLVSMNAIEKLGGMRGLDMNSAEEAIVKNTREVTKGLIIGGMELSEIDGWHRMGPI
FSAMMLSGVKAAEVALEVFEQRKKECAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctactgtcactgaaaccgttaccctgcccacccatcttgccaacaagaccgaattg
gttggacacccccccactgttaatagcaaggaagcgggtgatcgtgctctcttggacgaa
tttgctgggaaatgggatagttttaagtttggtcccattcgtgagagccaggtctctcgt
gccatgaccaggcgatacttcaaggacctggacacttacgctgagagtgacatcgtcatt
gtcggcgccggttcctgcggcctcagcactgcctatgtcctcgccaaggcgcgtcctgac
ctgaaaattgccatcattgaagctgccgtctctcctggcggtggtgcatggctcggcggt
cagctcttctccgccatggtcctccgcaaacctgcggacaaattcctcgacgaaatcggc
gtcccttacgaagaggagccttccaacccgcatgttgtcgtgatcaaacacgcctcgctc
ttcacctccaccttgctctctaaggttcttgcattccccaacatcaagctcttcaacgcc
acctgcgttgaggaccttatcacccgcccagaaccggccggtggcctgcgcatcgccggt
gtggtgaccaactggaccctcgtggctgaacaccatgacgatcactcctgcatggacccc
aacaccatcaatacacctctcgtcatcagcaccaccggccacgatggtccttttggcgcc
ttctgtgccaagcgtctcgtctcgatgaacgccatcgagaaattaggcggtatgcgtggc
ttggatatgaactctgctgaagaggctattgtcaagaatacccgtgaagtcaccaagggt
ttgatcatcggtggaatggaacttagtgagattgacggatggcaccgcatgggccctatc
ttctctgccatgatgctcagcggcgttaaggctgcagaggttgctctggaggtctttgag
cagcgcaagaaagaatgtgcggcttaa

DBGET integrated database retrieval system