KEGG   Coccidioides immitis: CIMG_02494Help
Entry
CIMG_02494        CDS       T01114                                 

Definition
(RefSeq) hsp70-like protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cim  Coccidioides immitis
Pathway
cim03040  Spliceosome
cim04141  Protein processing in endoplasmic reticulum
cim04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    CIMG_02494
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CIMG_02494
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    CIMG_02494
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cim01009]
    CIMG_02494
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cim03041]
    CIMG_02494
   03009 Ribosome biogenesis [BR:cim03009]
    CIMG_02494
   03110 Chaperones and folding catalysts [BR:cim03110]
    CIMG_02494
   04131 Membrane trafficking [BR:cim04131]
    CIMG_02494
   03051 Proteasome [BR:cim03051]
    CIMG_02494
   03029 Mitochondrial biogenesis [BR:cim03029]
    CIMG_02494
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cim04147]
    CIMG_02494
Protein phosphatases and associated proteins [BR:cim01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CIMG_02494
Spliceosome [BR:cim03041]
 Complex B
  Other components
   Prp19 complex
    CIMG_02494
 Complex C
   Prp19-CDC5 complex
    CIMG_02494
Ribosome biogenesis [BR:cim03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    CIMG_02494
Chaperones and folding catalysts [BR:cim03110]
 Heat shock proteins
  HSP70 / DNAK
   CIMG_02494
Membrane trafficking [BR:cim04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    CIMG_02494
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    CIMG_02494
Proteasome [BR:cim03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    CIMG_02494
Mitochondrial biogenesis [BR:cim03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    CIMG_02494
Exosome [BR:cim04147]
 Exosomal proteins
  Proteins found in most exosomes
   CIMG_02494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C StbA Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 4567580
NCBI-ProteinID: XP_001248723
UniProt: J3KLI0
AA seq 650 aa AA seqDB search
MAPAIGIDLGTTYSCVGIFRDDRIEIIANDQGNRTTPSFVAFTDTERLIGDAAKNQVAMN
PVNTVFDAKRLIGRKFNDAEVQADMKHFPFKIVDKGGKPIIQVEFKGETKQFTPEEISSM
VLTKMRETAESYLGGTVNNAVVTVPAYFNDSQRQATKDAGLIAGLNVLRIINEPTAAAIA
YGLDKKVDGERNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRLVNHFV
NEFKRKHKKDLSVNARALRRLRTACERAKRTLSSAAQTSIEIDSLFEGIDFYTSITRARF
EELCQDLFRSTMEPVERVLRDAKIDKSSVHEIVLVGGSTRIPKIQKMVSDFFNGKEPNKS
INPDEAVAYGAAVQAAILSGDTSSKSTNEILLLDVAPLSLGIETAGGVMTPLIKRNTTIP
TKKSETFSTFSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQIEVTFDLD
ANGIMNVSALEKGTGKTNKIVITNDKGRLSKEEIERMLAEAEKYKAEDEAEASRISAKNG
LESYAYSLRNTMSDSKVDEKLDAADKEKLKTEIDKIVAWLDDNQTASKEEYEDKQKELEG
VANPIMMKFYGSGEGGAPGGFPGAGAGGPGGFPGAGGPGGDDGPTVEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgcaattggtattgatttgggtaccacctactcctgcgtgggtatcttcaga
gatgatcgcattgaaatcattgcaaacgaccagggaaatcgcaccaccccatcattcgtt
gccttcacagacaccgagcgcttgattggtgacgctgcaaagaaccaagtcgccatgaac
cccgtaaacacagtcttcgatgccaagcgtctcatcggtcgtaaattcaacgatgctgag
gtccaagccgacatgaagcacttccccttcaagatcgtcgataagggcggcaagcccatc
atccaagttgaatttaaaggcgagaccaaacagttcacaccggaggaaatctcctccatg
gtcttgacgaaaatgagggagacggccgagtcttatcttggcggcacagttaacaatgct
gtcgtaaccgtgccagcttacttcaacgactcccagcgccaggctactaaggatgccggt
ctgattgctggtctcaacgttctccgtatcatcaacgagcccactgccgccgctattgct
tacggccttgacaagaaggtcgatggcgagcgtaatgttctgatcttcgatttgggtggt
ggtactttcgatgtttccctcttgaccattgaggagggtatcttcgaagttaagtctact
gccggtgacacccacttgggtggtgaggactttgataaccgtctcgtcaaccacttcgtc
aacgagttcaagcgcaagcacaagaaggatctttccgtcaatgctcgtgctctccgtcgt
ctccgcactgcttgcgagcgtgccaagcgcactctttcttctgccgctcagacttccatc
gaaattgactctctcttcgagggtatcgacttctacacctctattacccgtgctcgtttc
gaagaactctgccaggacctcttccgctccaccatggagcccgtcgagcgtgtcctccgt
gacgctaagatcgacaaatcctctgtccacgaaattgtcttggtcggtggctctacccgt
attcccaagatccagaagatggtttccgacttcttcaatggaaaggagcccaacaagtcc
atcaaccctgacgaggctgtcgcctatggtgccgctgttcaagctgctatcctctctggc
gatacctcttccaagtctaccaacgaaattctccttctcgacgttgctcctctttccttg
ggtatcgaaaccgctggtggtgtcatgactcctctcatcaagcgcaacactaccatccca
accaagaagtccgagaccttctccaccttctccgacaaccagcctggtgtcctgatccag
gtctatgaaggtgaacgtgctcgtaccaaagacaacaacttgctcggtaaatttgaactt
actggcattcctcctgccccacgtggtgttcctcagatcgaggtcaccttcgatcttgat
gccaacggtatcatgaatgtttctgctctcgagaagggtactggaaagaccaacaagatc
gtcattaccaatgacaagggtcgtctctccaaggaggaaatcgaacgcatgttggctgag
gccgagaagtacaaggccgaagacgaggctgaagcctcccgcatcagcgccaagaacggt
ctcgaatcctatgcctactccctccgcaacaccatgagcgactccaaggtcgatgagaag
ctcgacgctgctgataaggagaagctcaagactgagatcgacaaaatcgttgcctggctc
gatgacaaccagaccgcctccaaggaagaatatgaagacaagcagaaggaacttgaaggt
gttgccaacccaatcatgatgaagttctacggatccggtgagggtggagctccaggtgga
ttccccggtgccggtgccggtggtcctggcggattccctggtgctggtggtcccggaggt
gatgacggcccaaccgttgaggaggtcgactaa

DBGET integrated database retrieval system