KEGG   Coccidioides immitis: CIMG_02517
Entry
CIMG_02517        CDS       T01114                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cim  Coccidioides immitis
Pathway
cim00100  Steroid biosynthesis
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    CIMG_02517
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     CIMG_02517
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 4567369
NCBI-ProteinID: XP_001248746
UniProt: J3KLJ0
AA seq 480 aa
MARQKPKYEFGGPPGATAIVLGLPVLMNFLYFTCNDVTGCPAPALLDIRTLTWESLKSQI
PWPRDGILGFASWKATKWTLAYYLLSLVLYRVLPAQEVYGTKLRESGRPLKYRFNAFYAT
IVQLAACAVGTYLYGANFVVWTFITDNYLQILSANIIIAYVLSVYVYIGSFGVKPGNSEM
RELARGGHTGNMIYDFYIGRELNPRITLPFIGEVDLKAWFEMRPGLTGWALLNLAFVAKQ
YRTYGYVTDSIFIITAVQGYYVLDGQYAETGILGMMDITTDGLGFMLSFGDIVWVPFLYS
TQCRYLSVYPVQLGWMGLVAVSTVFAIGLYIFRAANGQKNTFRTNPNHPSVAGMSYIQTK
RGTRLLTAGWWGVARHINYFGDWTQSLPFSLPTAFAGYLIFPANSHVADVGVTKMLDGRE
VIQGAARGWGTLYTYFYAVWFATMLIHRERRDDAACAEKYGDDWDKYKKVVKWRIVPGIY
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggccagacagaaacccaagtatgaattcgggggccctccaggggccactgctatcgtc
cttggccttccagtgctgatgaattttctctatttcacctgcaatgatgtgaccggctgt
ccagcaccagctcttctagatatccgcactcttacctgggaaagcttaaagtcgcaaatc
ccgtggccacgggatggcatcttgggtttcgcgagctggaaagctacaaagtggacgcta
gcttattatctgctcagcttggtcctgtatcgggtgcttccggctcaggaggtatacggg
accaaattgcgcgagtctggccgtccgctcaaataccgcttcaatgctttctatgccacc
attgtccaattggccgcatgcgcggtcggcacctacctctatggtgcgaacttcgtcgtt
tggacattcatcaccgacaactacttgcaaattctgagcgctaatatcatcatcgcctat
gtcctttcggtgtacgtctacattggtagttttggtgtgaaacctggtaacagcgagatg
cgagaactcgccaggggaggccacactggaaatatgatctacgatttttacattggacgt
gaactaaatccccgaatcacgctccccttcattggcgaagttgatctcaaggcctggttc
gagatgcgtcccggtctgaccggttgggcgttgctcaacctagccttcgttgctaagcaa
taccgtacgtacggctacgtaaccgacagcatctttatcataacggcggtgcagggctat
tacgtactcgatggtcagtatgcggaaacaggcattctgggcatgatggacatcaccacg
gacggactaggatttatgctcagtttcggggatatcgtttgggtgccgttcttgtactcg
acccagtgtcgctatctctcagtctacccggtacaactggggtggatgggacttgtcgca
gttagtactgtgttcgccatcggcctgtatatcttccgcgccgccaacggccagaaaaac
acctttcgcactaaccccaatcaccctagcgtcgcgggcatgtcgtacatacaaacaaag
agaggcacaaggctactcactgccggatggtggggagtcgcacggcatattaattacttt
ggggactggacgcagtcattgccttttagtctcccgacagcttttgcgggctacctcatt
tttccagccaatagccacgttgcagatgtgggtgtcactaagatgctcgatggccgggag
gtgatccagggcgccgcacgagggtggggcactctttatacgtatttctacgctgtgtgg
tttgccactatgctcattcatcgtgaacggagagacgatgccgcctgtgcagagaagtat
ggcgatgactgggacaagtacaaaaaggttgtgaaatggagaatcgttcccggcatctat
tag

DBGET integrated database retrieval system