KEGG   Coccidioides immitis: CIMG_02704Help
Entry
CIMG_02704        CDS       T01114                                 

Definition
(RefSeq) calcineurin subunit B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    CIMG_02704
Protein phosphatases and associated proteins [BR:cim01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CIMG_02704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 4567872
NCBI-ProteinID: XP_004445611
UniProt: A0A0D8JSK0
Structure
PDB: 

AA seq 191 aa AA seqDB search
MTEQDNNAESYDATKRQQTSSSSQVLNDIVSGSNFDHEEVDRLWKRFMKLDRDKSGTIER
DEFLSLPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYD
IDRDGFISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADLDGDGRISFEEFTRMVENT
DVSMSMTLDQF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaagacaacaatgcagaatcatatgacgcaacaaagcggcagcaaaccagt
tccagctcgcaagtcctaaatgatattgtgtcaggatctaattttgatcatgaagaagtt
gacaggctgtggaaacgcttcatgaagttggatagagataaatctggcactatcgagcgt
gatgaattcctttccctcccacaagtctcttcgaacccgctttcaacccgaatgatagcc
atctttgacgaagacggcggtggtgatgtcgatttccaagaatttgtgtccggcctatca
gcgttcagctcaaagggcaacaaagaggagaaactccgtttcgcattcaaagtatacgat
atcgaccgcgacggttttatttccaacggagaattgttcattgtattgaagatgatggtg
ggaagtaatttgaaggatatgcagctacagcagattgttgacaagacgatcatggaagct
gatttggacggcgacgggagaataagtttcgaggaatttacaaggatggtggaaaataca
gatgttagtatgagtatgacattggatcaattctaa

DBGET integrated database retrieval system