KEGG   Coccidioides immitis: CIMG_03039Help
Entry
CIMG_03039        CDS       T01114                                 

Definition
(RefSeq) phosphatase
  KO
K15529  ADP-ribose 1''-phosphate phosphatase [EC:3.1.3.84]
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIMG_03039
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.84  ADP-ribose 1''-phosphate phosphatase
     CIMG_03039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 4564199
NCBI-ProteinID: XP_001243598
UniProt: J3KAG8
AA seq 237 aa AA seqDB search
MSRITETEGDLFDAPENTALIHACNCQGSWGKGIAETFRAKYPAAYRIYRSHCQRYLVDG
KKLSENSKDTPGRVLRYPEGTALLIPPQPDDYIPQNGPDSAVTPSTQGKKGGGRATRKSL
PKHRPAGKKHWIVCLFTSWHYSAKLKSSPDVILENTILALGDLKRQLEELQSSKRDGRES
ALDVSEKEKRRQVEAPTEIWSCRFNARLFGVPWQKTKALMEESGWQVTVVRPVGEPL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagccggattacagagacggagggcgacctgttcgacgcccccgagaacaccgcattg
attcatgcatgcaattgtcaagggtcatggggaaaaggcatcgcagagacatttagggcg
aagtaccccgcggcataccgcatataccgctctcattgtcagagatacctcgttgacggg
aagaaactctccgaaaactccaaggatacaccggggcgggtattgagatatcctgaaggt
actgcattactcattccaccgcaacctgatgattatattccccaaaatggcccagactct
gctgtcacaccatctacccaggggaagaagggcggtggtcgagctacacggaaatccctt
cccaaacacaggccagcgggcaaaaaacactggatagtatgtttatttacatcatggcat
tactctgcgaagttgaagagctcgccggatgtaattcttgaaaacacaatcctggccctg
ggagacttgaagagacaacttgaagagctgcagtcttcaaagagagatggaagagagagt
gcccttgatgttagcgagaaagaaaaaaggagacaggtggaagcgcccactgagatttgg
tcttgtcggtttaatgctagattgtttggcgttccctggcagaagacaaaggctctcatg
gaggaatcggggtggcaggttacagtagttcgccctgttggggaacctttgtaa

DBGET integrated database retrieval system