KEGG   Coccidioides immitis: CIMG_03073Help
Entry
CIMG_03073        CDS       T01114                                 

Definition
(RefSeq) choline kinase
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
cim  Coccidioides immitis
Pathway
cim00564  Glycerophospholipid metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CIMG_03073
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CIMG_03073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase Choline_kin_N APH
Motif
Other DBs
NCBI-GeneID: 4564385
NCBI-ProteinID: XP_001243632
UniProt: J3KAJ7
AA seq 787 aa AA seqDB search
MSILQVTLCANDGSGNGGSTSGQPGEDTLDHTVRPFQTSNTQLPTINAENVDNPTSDTRQ
IRQHRASIGGKKVIARTLPHASSSSLNSLSSQRASSKLDGANPSAEDTDPGARSSDESRQ
GQYSLFLQVFSWLQNERTKLAARRQKVGDEHGSAEAPDSNTSESRTDDMEFALDQLERIL
AQYSSSRENIRPRGSMTPRQRAAAVKKLRRGSHSDSDYTDTDQGVPSADVTLDNSKALLY
SGGEADSDVDALEVKPSAKDRENWLKFKFEVVRLVHTLGLKGWRRVPLEVSGEVEVVRLS
GALTNAVYVVSPPKNLPMAQRSESSLPSVPRKPPPKLLLRVYGPQVEHLIDRERELQILR
RLGKRNIGPRVLGTFNNGRFEQYFHAKPLTTKELRVPETSKQISKRMRELHDGIDLLPEE
RESGPSLWKNWDKWVGRCEKVTTWLDQEILNGNNSSKASNEPWRWRGFVCCVPWQSFRAV
VDRYRKWLEEHFGGAGEISKRLVFAHNDTQYGNLLRLQPSEESPLLLPANEHKQLIVIDF
EYASANMRGVEFANHFTEWCYNYHDAERPWACHTNWYPTQEEQERFIRAYLRHQSGLTAQ
PADISTPPATHPSVSVTRPTHTSSPRVPPFLLDTYVPGVSPPLTDYENRDPAEEAEVQHL
LHETRLWRVANSVQWIAWGIVQAHVPGMNKALSKQDTANIPAPGSSVPSEPEKSDEQQPA
DYTQEVNHEQVKQEVEAEEAADEFDYLAYAQDRALFFWSDLLALGFIKEEELPADMIEDI
KKRVIDY
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgtccatactgcaggtcacactgtgtgctaatgacgggagtgggaatggaggaagcacc
agtggtcaacctggtgaggacacattggatcacactgtcaggcctttccaaacgtccaat
acgcaattgccaacaataaatgcggagaatgtggacaaccccacgtccgacacccggcag
ataaggcaacatcgtgcgagcattggcgggaagaaggtaatagcgcggacattgccacac
gcttcttcttcatctctgaactcccttagcagtcaaagggccagctcaaagctagacggg
gccaacccaagcgccgaggatacagatccaggcgcacgaagctctgatgaatcccgtcag
ggccagtactcgctcttcctgcaagtattcagctggctgcagaacgaaaggaccaagctg
gctgctcgaaggcagaaagttggagatgaacatgggtccgcggaagcgccggattcgaac
acttccgagtctagaacggatgacatggagttcgccctggaccagcttgagcgtatactg
gcacaatactcgagttctcgggagaatattcgtcctagaggttcaatgacaccgaggcaa
cgggcagcagcagtcaagaaactacgacgaggatcccattccgattctgactacacggac
actgatcaaggcgtacctagcgccgatgttaccttggataattccaaggcacttctctat
tccggcggcgaggcggatagtgacgtcgacgctctcgaagttaagccctcagctaaggat
cgcgagaactggctgaaatttaaattcgaagtcgtccgtttggttcataccttagggctc
aagggttggagaagggtacccttggaggtcagcggcgaagtagaagtcgtgcgcctaagc
ggagcattgaccaatgctgtttacgtcgtttcaccgcccaaaaaccttccgatggctcaa
agatcagagtcgtcattgccatcagtgccgcggaaacctcccccgaagcttctcctccgt
gtttatgggcctcaggtggaacaccttatcgacagagagcgcgagctgcaaattctccgt
cgtttaggaaagaggaatatcggaccccgtgttttgggtactttcaacaacggacgtttc
gaacagtatttccatgcaaaacctctaaccactaaagaactacgtgttcccgagacctcc
aagcaaatctcaaaacgcatgagagagcttcatgacggcatcgatctactcccagaagag
cgagagagtggaccctccttgtggaaaaactgggataaatgggtcggacgctgtgagaag
gttactacctggctggatcaagagatcctgaatggtaataatagctcaaaggcttccaat
gagccctggagatggcgcggtttcgtgtgctgcgttccctggcagagcttccgggccgtg
gtggataggtatcggaaatggctggaagaacattttggcggcgcaggggagatttccaag
cggctggtatttgcgcacaacgatacacaatatggcaaccttctccgactacaacctagc
gaagagtcaccgctgttgctccccgccaacgaacataagcagctgattgtcattgacttt
gagtatgcatccgctaacatgcgtggtgtcgagtttgcgaatcattttaccgagtggtgt
tataattatcatgatgcagaacgcccatgggcgtgccatacaaattggtatcccacccag
gaagaacaggaacggttcatccgggcatatctgcgtcaccaatccggtctgacagctcaa
cctgcggacatctccactccacctgcaacccacccatctgtttcagttacccgaccaact
cacactagcagcccgcgtgtacccccattccttcttgatacttacgttcctggagtgagc
ccacctctcacagattacgagaatcgtgatccagccgaagaagctgaagtgcagcacctt
ctccacgagacacgtttgtggcgggttgcgaactcagtgcagtggatagcatggggaatc
gtgcaagcacatgtccccggaatgaataaagctctttctaaacaggacaccgcaaatatt
ccggcccctggaagctctgttcctagcgaaccagagaagagcgatgagcagcaaccggcc
gattatactcaggaggttaaccatgaacaggtgaagcaagaagtcgaggctgaagaggcg
gctgatgagttcgactatctcgcctacgcgcaggatcgggctctttttttctggtccgat
ctgctggcattgggattcataaaggaggaagaattaccggcggacatgatagaagatatc
aagaaacgggtgattgactattaa

DBGET integrated database retrieval system