KEGG   Coccidioides immitis: CIMG_03508Help
Entry
CIMG_03508        CDS       T01114                                 

Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
cim  Coccidioides immitis
Pathway
cim03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cim00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CIMG_03508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cim03009]
    CIMG_03508
Ribosome biogenesis [BR:cim03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    CIMG_03508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT HTH_3
Motif
Other DBs
NCBI-GeneID: 4564539
NCBI-ProteinID: XP_001244067
UniProt: Q1E1Q5
AA seq 607 aa AA seqDB search
MTLFILTETSAGYALLKAKDKKLLKRDDLEKETQTAEGVSNLLKLKNFQKFDSATTALEE
VASLVEGKVTPRLASLLESIKDEKKVSLAVADPKLGNAIGKLPGLSIQAIADSTTADLYR
AIRAHLPTLIPGLLPTDMSTMALGLSHSLARHKLKFSPDKIDTMIVQAIALLDDLDKELN
TYAMRVKEWYGWHFPEMAKILNDNMAYAKVVLKMGMRSNSDSADLSEILPEEIEGAVKAA
ANRSMGTDISNEDLENIQCLAEQVVGFAEYRQQLASYLTARMTAIAPNLTALVGELVGAR
LIAHAGSLVNLSKSPASTIQILGAEKALFRALKTKHDTPKYGLIYHASLIGQATGKNKGK
MARVLAAKAAIGLRVDALAEWEKDADGNEPTEEERAALGMESRYYLEKKLAAMEGKPLKP
RGVGIAPNGIPIEQPKKWDIKEARKHNPDADGLTGDEPAATENVSKKSKKDKKLVEEIKD
EEMKDAPESEEEEEASEAEESEEEKPKKSKKKESKTSKGKDSDEAKIEELAEKAGLSVKR
YLRKLERGEINFDEDGNPTAISKKELKKAKKEAKKAEKDAGKKRKRDEDEEPAESKSEKK
KKKKSKA
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttcattctcacggagaccagtgctggttatgcactgctcaaagcaaaggac
aagaagctgctcaagagagatgaccttgagaaggaaacacagactgcggaaggagtgtct
aatctcttgaaattgaagaatttccagaaatttgatagcgcgacgacagccctcgaggag
gttgcttccctcgtcgaaggaaaggtcacgccgcgtcttgcaagtcttctcgagtccatt
aaagatgaaaaaaaagtttcgttggccgttgcggatcctaaactcggaaacgcgattgga
aagctccctgggctttcgatccaagcgattgccgactcgaccactgcagatctttacaga
gctatcagagcccatcttccgacgctgatcccaggacttctccctactgatatgtccact
atggcactcggtctttctcattcacttgcaagacataagcttaaattttccccggataag
atcgatactatgatcgtgcaagcaatcgccttgctcgatgatctcgacaaggaattgaac
acatacgcgatgagagtcaaggaatggtatggctggcatttcccagaaatggccaagatt
ttaaatgataatatggcatatgccaaagttgtcctgaagatgggcatgcgttcgaattcg
gattcagcagatttaagcgaaattcttcccgaagagatcgagggcgcggttaaggcggca
gcgaatcgatccatgggtactgacatcagtaatgaagatttggaaaacatccagtgttta
gcagaacaagtggttggatttgcggaataccgtcagcagttggcgagttacttgacagcg
cgtatgactgccatcgcacccaatcttaccgctttggttggcgaactggttggtgcgaga
cttattgcccatgcaggaagcttggtcaatctgtcaaagagccctgcgagtacgatccag
attttaggagcggagaaggccctgttccgcgctctgaagacgaaacatgataccccgaaa
tatggcctcatctatcacgcatcacttatcgggcaagccactggaaagaacaaaggaaaa
atggcccgtgtcttggctgccaaggcagctatcggtctccgtgtggacgctcttgctgag
tgggagaaagatgccgacggcaacgaaccaacagaagaagagagagccgctctgggtatg
gaatcaagatattatcttgaaaagaaactggctgccatggagggcaaaccgttgaaaccg
agaggcgttggcatcgctccgaatggtataccaatcgaacagccgaagaaatgggatatc
aaggaggctagaaaacataatccagatgccgatggcctgactggcgatgagccagctgcc
acagagaatgtgagcaagaaatctaaaaaagacaaaaaattagtagaggaaatcaaggat
gaagaaatgaaggatgcacctgaatctgaagaagaagaggaagcttctgaagcagaggag
agcgaagaggagaagccgaagaagtccaagaagaaggaaagcaagacatcaaagggcaag
gattccgacgaggctaagatcgaagagcttgctgaaaaggccgggctcagtgttaagagg
tacctgagaaagcttgaacgaggtgaaatcaatttcgacgaagatggcaaccctactgcc
attagcaagaaagagctcaaaaaggcaaagaaggaggcaaagaaggcggagaaggatgcc
gggaagaaacgaaagcgggatgaagacgaagagcccgctgaatccaagagcgagaaaaag
aagaagaagaagagcaaggcctag

DBGET integrated database retrieval system