KEGG   Coccidioides immitis: CIMG_04712Help
Entry
CIMG_04712        CDS       T01114                                 

Definition
(RefSeq) separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
cim  Coccidioides immitis
Pathway
cim04111  Cell cycle - yeast
cim04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cim00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CIMG_04712
   04113 Meiosis - yeast
    CIMG_04712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cim01002]
    CIMG_04712
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cim03036]
    CIMG_04712
Enzymes [BR:cim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     CIMG_04712
Peptidases and inhibitors [BR:cim01002]
 Cysteine peptidases
  Family C50: separase family
   CIMG_04712
Chromosome and associated proteins [BR:cim03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    CIMG_04712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 4564962
NCBI-ProteinID: XP_001245271
UniProt: A0A0E1RXC5
AA seq 2124 aa AA seqDB search
MANQTLHSLVDSVKSSVLSPSTCTSDTVSLLRKLLSAVDDERKTGERKSAKTVKAGSSSR
RQPRTGNSRATTKVAVFQTRTESPIPPLSKQNKIALATEIFNASSRTLSEHIKLQSPRPF
DNALKKNTVTKNPGSPKKPLQPTSPNRTIRSPTKAKGISERLNERNTAASNVTGVAESAL
LALSSLRDLKCNEDGTRILNVQLEQGLCILIGKLFAVGLNNMAIRELRLLKGRIRAYFDS
ETPKVKLRRTANPAKEIQSERASEKMEDLVLVPKVPEDGAMIQLFVSLQNLALRAVITEG
QPATAQKMMNHLVFSNPCSPPNLILAAYKFGTLSADKAAQQLQSLSSSILSLAALTVSPG
EGVPCSMKSRIKPTVTVALQILSLEVKCLWWKMAGHRYDADKELWHPLARYFSALTRHCS
AIKKADFECIKEAFLRLKTSLNSNGYNVNIRNVKSASVSIVLRILGQLAYTAGCLSDAIE
FCKASTACLTASQPLQLAICCCKTAFVQIEFLKTSPRHRREISSAISDAANNLSAPLKGN
LTDLDELLMEAAKLKKTIMKAVNGLTDAAVVDNTMTFDVESLWLSINEYLMSFVRFLSRY
LGPSPPFDAEANSKAGFMLRLGTCKNIAISAVDSSIAVAKISLSTEQPPWGRISPLLIDC
FGLLNRLSYDHCNNDNNQASNGVSSGLLRLSNLYWSRYAAQKEAGKSAFELVPLLERSIN
ILGHCAPAEQTSGFIAIKIERLATIYSEIGHEAKAETNYCSAIRAHIIAGTLELASAQSF
QRPFRYIWKNPQSPAYALGRVLGSYIKARLKQVRKTSQLAYDDEALDVESRALLLESQMA
FLVDSFAVDPSDMLAQCLASMITKLLAIYSIDIFPLRRSRVLVSSLRLFLESNIDFDSDF
CDYLSQEAKSCLSQGLELYKDQDLYPYQEDIMSSLRLALGFYSGDLQTADLQLVIQSWAK
MSQSWATWESVEAKISDPHTWISQLRGLVDYLEIKAQWMQQITLLSVLEKVLELQEKRDF
SLLVTSLSIMGVQLSRLGFPDRAGEVLTRAKEVIGQHAICPSVLISWHLAYAEYLVEMGR
PEKSFEVLQDAQMVFETNIGEMAKDSMRMRSCLDKIGIDAACILSRITFTEGKIGEATFY
AKNAVKLSSRLWARLEKYSNLKTDKKVADNIEEADALTEKLANVDLSSAGKEPAKGYRTG
SVYWPYFSSHCTALQQLSRISANNGLYQDAVYYAQLALDASEALGATCLATLIKAELGSY
NIRGNQVDKGQELLKALEAELPTVHETIHTVALRYHVSALHEFSGKLEEEYEMLDACHNA
LAELLRTGITELPCRPNSEIDEIQTKIKELSLDTRNESRPQRKTRHAQRSGKTSKQSEKA
SVTKTYGEPGLPRASSLLQLRGDILRRQAEALLSNGRLQDAGILLDEAEKLTSSKNSHVS
QCIRRANLYLNEAVHKLASHGVYCVLPESCIALSSVQQTESAQDLASSATSSASSPKKKS
KPSRLVGEDFTGILSTARQDLYTFSPLAVTHCSTMDCHVFSYLTSKVSALSYATSKGGDF
IDPFSTLQLKETGRDTALLREHCAIMADKQLSESAKLPKWPLVPDIRTNGNSLQFSDVSK
DCIDLLPDTWNVVSISLGVDHNEFVISKLRAGQAPFMLCLPLKRSDSDDDDEETFSFDDG
KAELLEIIKLANRSAHDTRARVDKKAKKEWWANREALDTRLKDLLHNIENIWFGGFRGIF
SQKPKNEALLSRFIHSFEKTLNKHLPSRRGKRGKNKDCRLSLDRNVMELFVNIRRLSDED
DPEDSVMDLLYFVVDALQFQGERNAYDEIDFDMMVIETLDALRSYAEAEQREENSQPQPH
TILILDKTLHSFPWESLDCLQGCSVSRIPSLHCLRERLFDIKAQQGANVSRQGYHIKKES
GAFILNPSGDLKSTQNTFQFPLSKFDGWTNITQKEPSEEDFRGALESKDLLLYFGHGSGA
QYIRGRTIKRLDRCAVTFLMGCSSGAMIEAGEFEPYGTPWNYMQAGSPALVATLWDVTDK
DIDRFAEGVFKQWGLFSSEEENPGLGRLSRKNGKMADNSESGLGLEEPGSVGLDTAVARS
RDACILKYLNGAAPVVYGVPVFLE
NT seq 6375 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatcaaacattgcactcactggttgattcagtgaagagctccgtcctcagcccg
tcaacctgcactagcgacaccgtatcgttgttgcgcaaactcctttcagccgtggatgac
gaacgcaaaactggggagcgcaaaagtgcaaagactgtcaaggctggctcatcctctcgt
cgccagccaaggacgggtaattctagagctaccacaaaagtggccgtttttcagactaga
accgagtctcccattcctccactctcgaaacagaacaaaatagccttggccacggaaata
ttcaatgcttcctcaagaacactctccgaacatattaaacttcaatccccgcgaccattt
gataatgccctaaaaaagaatacggttacgaaaaacccgggatcaccgaagaaaccgctt
cagcctacctccccgaatcgaacaatccgatcaccaacgaaagccaaaggaatttcggaa
aggttgaatgagcgaaacacagcagcgagcaatgtcacaggggttgcagaatcggcgctg
ttagctttatctagccttcgagatctaaaatgtaatgaagatggaactcgaattcttaac
gtccaattggaacaagggctttgtatcttgatcgggaagctatttgccgttgggctcaac
aatatggcaattagggagctacggctattgaaaggcagaatacgagcatatttcgatagc
gaaactccaaaagtgaaacttagacggacagccaatccagccaaagaaatccaaagcgag
cgggcaagcgaaaaaatggaggacctcgttcttgttccgaaagtaccagaagatggcgct
atgattcaactttttgtttctcttcaaaatctagcattgagagccgtcatcactgagggt
caacctgccacagcgcagaagatgatgaatcatttggtattttccaatccttgcagccca
cccaatcttattcttgcggcgtacaaatttggcacactctctgcagataaggccgctcaa
caattgcaatccctttccagttcaattctatcccttgccgcgttaacggtatctccggga
gagggggtcccttgcagcatgaaatcgcgaatcaagcctactgtgacagtagcgttgcaa
attctctctctcgaagtaaagtgcctatggtggaagatggcaggacatcgatacgacgct
gataaggagctatggcaccctctcgctcggtacttctcggcattgacacgacattgttcg
gccatcaagaaagctgactttgaatgtatcaaggaagcatttctgcgacttaaaacgagc
ttgaactcgaacggatacaatgtgaacattcgaaatgttaagtctgcctccgtatccata
gtgctgcgaattttgggccagttagcgtatacagccgggtgtctatccgatgcaattgag
ttctgtaaagcttccactgcttgtctgacagcttcacagccattgcaattagctatttgt
tgttgcaaaactgcttttgtccagatcgaatttctaaagacctcccctcgtcatcggcgg
gagataagttcggcgatttctgacgcagcgaacaatctaagtgctccattgaagggcaat
ttaaccgacttggacgaattgctcatggaggctgcaaaactcaaaaaaacgattatgaaa
gcggtgaatggcttgacagatgctgcggttgtcgataatactatgacattcgatgttgag
agtttatggctcagtattaatgagtacctcatgagttttgttcgtttccttagccgttat
ctgggcccgtcgccaccgtttgatgcggaagcaaactcaaaggccgggtttatgctacga
cttgggacctgcaagaatatcgcgatttcagccgttgattctagcatcgctgtagccaaa
atatcattgagcacggaacaacctccctggggaagaattagcccgctcttaatcgactgc
tttggccttctcaaccgtctcagctacgaccattgcaataatgacaataaccaggcatcc
aatggcgtatcttccggccttctcagattatccaatctctactggtcacgatacgctgcg
cagaaggaagctgggaaatcagcgtttgaactcgttcctctgctagagcgatcaataaat
atcctagggcactgtgcaccggctgaacagacttcaggtttcattgctatcaaaatcgag
agacttgccactatttattcggagatagggcatgaggcaaaagcagagaccaattactgc
tctgcaattcgcgcgcacataatagctggcactctggagttggccagtgcccagtccttc
cagaggcccttccgctacatttggaaaaacccccaaagtcctgcgtatgcgttgggccgc
gtgctaggcagttacatcaaggctagattgaaacaagtacgcaagacctctcagcttgca
tatgacgatgaagcccttgatgttgagagtagggctctgttgctcgagagtcagatggcg
tttctagttgatagctttgccgttgatccctccgatatgttagctcaatgccttgcctct
atgatcacaaagctgcttgcaatatactctatagacatattccccctacgacggtcaagg
gtccttgtctccagcttaaggctattccttgaatcaaacattgactttgattctgatttc
tgcgattatctttcacaggaagcaaaatcatgtctttcccagggtttagagctctacaaa
gatcaggatttgtatccataccaagaggatataatgagttcgcttcgtctggcactgggg
ttttacagtggtgatttacagacggccgatttgcaacttgtcatccagtcatgggcgaaa
atgtcgcaaagctgggctacctgggaatcggtggaagctaaaatatccgatcctcacacc
tggatttctcaacttcgtggccttgtcgactatttggaaattaaggcgcaatggatgcag
caaataaccttgctgtcagtcctcgaaaaggtcctggagcttcaagagaaacgtgatttt
tccttgcttgtgacttcactgtccataatgggtgttcaattgagtcgcctcgggtttcct
gatagggcaggcgaagtactaacaagggcaaaggaggttattggacagcatgcgatatgc
ccgtcagttttaatatcatggcatcttgcgtacgctgaatatctcgtggagatggggcgc
ccggaaaaaagcttcgaggttcttcaagatgcccaaatggttttcgaaactaacattggc
gagatggctaaggattctatgcgcatgcgcagttgcctcgataaaataggaattgatgca
gcgtgtattctttcacgaataacattcactgaaggtaaaattggcgaggccacgttttat
gcaaagaatgcggtgaaattgagttcccgactttgggcaaggttggaaaagtattcaaat
ttgaaaacggataaaaaggtcgccgacaatatcgaagaggccgatgcccttacagagaaa
cttgctaacgtggacctgtcatctgccggcaaggagccggcgaagggttaccgcacagga
tccgtctactggccatatttttcatcccactgcactgcgttgcagcaattatcccggatc
tctgctaataatgggctgtatcaagatgctgtctattatgcccaactagctttagatgca
agcgaagctctcggggccacctgcttagccactctcatcaaggcagagctgggtagctat
aacatccgtggtaaccaagtggataagggtcaggaactgttgaaggcgttggaagcagaa
ttgccgacagtccacgagacaatccataccgtcgcattgcgataccacgtatctgcactc
catgaattcagcggcaaactggaagaagaatatgaaatgcttgatgcatgtcacaacgcc
ttggcggagctactgcgaactggaattaccgaattaccttgtcggccgaacagcgaaatt
gatgaaattcagacgaaaatcaaagaactaagcctcgacactagaaacgaatcccgaccc
cagcggaaaacaagacacgctcaacggtcaggaaaaactagcaaacagtcagaaaaagct
tcagttacgaaaacttacggagaacctggccttcctcgagcgtcctcgcttttgcagtta
cgcggcgatattttacgtcgacaggcggaggctttactctctaatggacgacttcaggat
gctggaattctcttagacgaagccgagaaacttacaagctcaaagaatagtcatgtttct
caatgcatccgcagagctaacctttatttgaacgaggctgttcataaacttgcgagccat
ggcgtttactgtgtccttcctgagtcttgtatcgccctatcctctgtccagcaaacagag
agcgcgcaggacctagcttcatcagccacaagttctgctagttctccaaagaaaaagtca
aagcccagtcgacttgttggagaagatttcaccgggattttatccacagccagacaagac
ctctataccttttccccgttggcagtgactcactgttcgacaatggactgccatgtcttt
tcttacttaacgagtaaagtgtcagctctatcatacgcaacatccaaaggtggtgatttt
atcgaccctttctctacattgcaacttaaagagaccggacgagatactgctttactacgg
gagcactgtgctatcatggccgataaacaactgagcgaatctgcaaaattgccgaaatgg
cccttggttccagacataaggacaaatggaaattcgctccagttttctgacgtttcgaaa
gactgtattgatctcctccccgatacttggaacgttgtctccataagcctgggcgttgac
cacaacgaatttgtaatatcgaaactgcgtgctggccaggcaccgtttatgctatgcctt
cctctaaaacgaagcgactcagacgacgatgatgaagagactttttcattcgatgatggc
aaggcagagttactggaaataataaaattagccaacagaagcgcccatgatacccgtgct
cgggtggataaaaaggccaaaaaggaatggtgggctaatcgggaggctctcgatacgcga
ctgaaagatctccttcacaacattgaaaatatatggttcggaggttttcggggaattttt
tctcagaagccgaagaatgaagctttgctttcgcgattcatccactcttttgagaaaact
ctcaataaacacttgccgtcaaggcgtggaaaaagagggaagaacaaggactgccggctc
agcttggaccgaaacgtcatggagctttttgtgaacattaggagactatcggatgaggat
gacccagaagactccgtgatggacctgctatactttgttgttgacgcgttgcaattccag
ggcgagaggaatgcgtacgacgaaattgattttgacatgatggtcattgaaaccttggat
gctttgcgaagctacgccgaagcggaacagagggaagaaaactctcagccacagccacat
acaattctcatacttgacaaaactcttcattcgttcccgtgggagtcattggattgtctg
caaggatgttccgtgtccaggataccatcgctccactgtttgcgcgaacggctctttgat
attaaggcccagcaaggggcaaatgtctcacgacaaggatatcatattaagaaagaaagc
ggagcgttcattctcaaccccagtggagatctcaaatcaacgcaaaacactttccaattt
ccgctctccaaattcgatggctggaccaacattactcaaaaagagcctagcgaagaagat
tttaggggagctctagaatctaaggatcttctcctctactttgggcatggaagcggcgcc
caatatatccgtggccgaacgataaaaaggcttgaccgctgcgccgtcacttttttgatg
ggatgtagtagcggagcaatgatcgaagctggcgaattcgaaccatatggtacaccttgg
aattatatgcaagctggctctcctgctttggttgctacgctctgggacgttaccgacaag
gatatcgatcgttttgcggaaggggttttcaagcagtggggcttgttttcctctgaggag
gagaaccccggactaggtcgcttatctaggaaaaatgggaagatggctgataactctgag
agtggtttagggttggaagagcctgggtcggttggcttggacactgcagttgcaagatca
agggatgcttgcattttgaaatatttgaatggcgcggcgccagttgtctatggtgttcct
gtgtttttggaataa

DBGET integrated database retrieval system