KEGG   Coccidioides immitis: CIMG_05765Help
Entry
CIMG_05765        CDS       T01114                                 

Definition
(RefSeq) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cim  Coccidioides immitis
Pathway
cim00430  Taurine and hypotaurine metabolism
cim00460  Cyanoamino acid metabolism
cim00480  Glutathione metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CIMG_05765
   00460 Cyanoamino acid metabolism
    CIMG_05765
   00480 Glutathione metabolism
    CIMG_05765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cim01002]
    CIMG_05765
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CIMG_05765
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CIMG_05765
Peptidases and inhibitors [BR:cim01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CIMG_05765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 4561703
NCBI-ProteinID: XP_001241869
UniProt: A0A0E1RWE4
AA seq 599 aa AA seqDB search
MLRSLLIMISPAVLALCVGFYIFSTFADLSCATPIRRHSSYPWLNQGSGRPDSGQEVDAW
ARQDDRLGAVASESSICSGFGIDMLKLGGNAADAMVATVFCVGVVGMYHSGIGGGGFMLI
RSPDDTYEFVDFRETAPAAAFQDMYNNNTDASIFGGLASGVPGEVRGLEYLHKKHGLLPW
RLVMQPAIHTARYGFPVTEDLVRYMREATEGKEDFLTNNPTWALDFAPNGTRLGLGDTIT
RKRYANTLETIANYGADAFYSSAIAETMIQALQAQNGTMTLEDLKNYTVDIKETAQIDYR
GFKVTSTSAPSSGAILLSTLNILEGYDDFFAQGTTDLSTHRLDEAIRFAYGQRTHMGDPR
FVEGLGEFQQDILNKSVSAQIRGKILDERTQNISAYEPSGFEILETPGTSHISSADRNGL
AISLTTTVNLYFGSKVMVPETGIIMNNEMNDFSIPGSDNAFGYRPSPANYIRPGKRPLSS
ICPTIVTHPNGTMYFVTGAAGGSRIITSTLQSVINVLDRHMTAPQALAEPRLHDQLVPNL
TEVEWSFDNSTVAFLIDRGHNITRVEHASSTVQSIRVLSNGTFEAAGEPRQLNSGGLAI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgctacgtagcttgctcatcatgatttctccggctgtccttgcgctgtgcgttggcttt
tacatcttttctaccttcgccgatttaagttgcgcaacgccgattagacgccattcgtct
tacccatggctgaatcaaggatctggtaggcctgattctggccaggaggttgatgcttgg
gcgagacaagatgatcgactgggtgcggtggcgagtgagagctccatatgtagcggattt
gggattgatatgctgaagctgggtgggaatgctgctgatgctatggtagccacagtcttt
tgtgtcggagtagttggaatgtaccatagtggcattggcggtggaggattcatgcttatt
cgatcgccggatgacacatatgagttcgtcgacttccgcgagacggcccctgcagcggcc
ttccaggacatgtacaacaacaacaccgatgcttcgattttcggtggcctagcaagcggt
gtccctggtgaagttcggggacttgaatatctgcacaagaagcatgggcttcttccatgg
cgcctcgtgatgcagcccgctatccacactgcccgttacggatttcccgtcaccgaagat
ttagtccgttacatgagagaggccactgaaggaaaagaagacttcctgacaaacaacccg
acttgggcgctggattttgctcctaacggtacacgtcttggacttggagacactatcaca
cgaaaacgatacgcaaataccctcgaaacgattgccaactatggtgccgacgcgttctat
tccagtgctattgcggagaccatgatccaggctctccaagcacagaatggcacgatgacc
ttggaggacttgaagaattatacggtcgatatcaaggaaactgcgcagatagattataga
ggattcaaagtcacgagtacatctgctccatcaagtggtgcaattcttttgagcactttg
aatattctagaaggttatgatgattttttcgcccaaggaactacggatctgagcactcat
cgtttagatgaagcaattcgattcgcatacggtcaaagaacacatatgggtgatccgcgc
ttcgtcgaaggactcggtgagttccagcaggatatactgaataaatccgtctccgctcag
attcgcggtaaaatcttggatgagcgcactcagaatatctctgcatacgagccatccggc
tttgagattcttgaaactcccggaacatctcatatttcctctgccgaccgcaacggcctc
gctatctctctaaccacaactgtcaacctctactttggcagcaaagtcatggtccctgaa
accggcataattatgaacaacgaaatgaatgatttctccatcccaggttccgacaacgct
ttcggctaccgcccttccccagctaactacattcgccccggaaaacgcccactctcatcc
atttgcccaaccatcgtcacccatcccaatgggacgatgtatttcgtcaccggtgctgcc
ggtgggtctcgtatcatcacttctaccctccaaagtgtcatcaacgttctcgatcgccat
atgactgccccacaagccctcgctgaaccacgtctacacgatcagcttgtcccgaaccta
acagaggttgaatggtctttcgataactccacggtggcgttcttgatcgaccgcggacac
aatatcaccagggttgagcacgcatcgagcacggtgcaatctatcagagtattgtcgaat
gggacatttgaggcggcaggtgagccgcgacagcttaactctggtgggctggcgatttga

DBGET integrated database retrieval system