KEGG   Coccidioides immitis: CIMG_06759Help
Entry
CIMG_06759        CDS       T01114                                 

Definition
(RefSeq) palmitoyltransferase pfa5
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIMG_06759
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     CIMG_06759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 4560924
NCBI-ProteinID: XP_001242863
UniProt: J3K8U9
AA seq 400 aa AA seqDB search
MASDKRVNIGAARVIPVVLGGLLAYGSYVFTRPLCIDYFISPPLHYGAPSPRRGLATGLL
IVFYLLLLVLAVSYFRVITTIIWNPGFLQRGNQWHQSRTGKPEGNTKRRKRRHRPGTSYP
DNANVEHAPYPIDAYGLEAFYCKDIFVCEQDGRPPWCSTCCQWKTDRAHHCSEVDRCTRK
LDHFCPWVGGVISESSFKFFIQFLFYTFLFTTFNVVVFSIVIAEYRRNSGYLEVQWLVAL
ALCGLFCLFSFGMLVSSLHLAFINSSTIESLTRHTKVWTLAVLIPRPKDFYELQSRRKSP
IPVVIYPSSPIPSSSSSTRTATSNAPPREFAILSTKPGENPFDLGSPLANLKEVMGHSLI
DWLLPLRYSPCSGYGSQESAYAFGPVVQRLKKENGLDCSE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagataagagagtaaacatcggtgcggcgcgagtcattcccgtggttctcggt
ggtttacttgcctatggaagttatgtctttacaagaccattatgcattgattattttata
agtcctccgctccactatggtgcaccttccccccgaagaggcctcgcgaccgggttgctg
atcgtgttctacctcctgctgcttgtgttggccgtgtcctacttccgagttatcaccacg
atcatatggaaccctgggttcctccagcgcgggaatcagtggcatcaatcgcgcaccggg
aaacccgaaggaaacacgaaacggagaaagcgacggcacagaccgggaacttcctaccca
gacaatgcgaacgtcgaacatgctccttaccctatcgatgcctacggcctggaggcgttt
tactgcaaagatatatttgtatgtgaacaagacggcaggcctccgtggtgctcaacctgt
tgccaatggaagacggatagggctcaccattgcagtgaggtcgatcgctgcaccagaaaa
ctcgaccatttttgtccctgggtcggaggcgtcattagcgaaagttcattcaaatttttt
atacagttcttattttatacctttctctttacgactttcaacgtcgtggtcttttctata
gttatcgccgaatatcgaagaaattctgggtacctggaagtgcaatggctggtggcttta
gcgctatgcggtttattttgcttattttcctttggaatgctagttagctcgctgcacctt
gcattcatcaactcttccaccatcgagagcctcactcgtcataccaaagtttggacctta
gcagttctaattccccgcccaaaggacttttacgaactccagtcccgccgcaaaagtcca
attcccgtcgttatatatccaagtagtcctattccttcttcttcgagttctaccagaaca
gccacctcaaatgctccacctcgcgaatttgccatcctatccacgaaaccgggagaaaat
ccctttgatctgggaagtcccctggcaaatttgaaagaagtcatgggccacagtttaatt
gattggctgctaccgctcagatatagcccgtgctcgggctacggtagtcaggaaagcgcg
tatgcgtttggccctgtggtgcagaggttaaagaaagagaatggcttggattgttcagaa
tga

DBGET integrated database retrieval system