KEGG   Coccidioides immitis: CIMG_07174Help
Entry
CIMG_07174        CDS       T01114                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cim  Coccidioides immitis
Pathway
cim00450  Selenocompound metabolism
cim00970  Aminoacyl-tRNA biosynthesis
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CIMG_07174
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CIMG_07174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cim01007]
    CIMG_07174
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cim03016]
    CIMG_07174
Enzymes [BR:cim01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CIMG_07174
Amino acid related enzymes [BR:cim01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CIMG_07174
Transfer RNA biogenesis [BR:cim03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CIMG_07174
 Prokaryotic type
   Other AARSs
    CIMG_07174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 RNA_polI_A34 PepSY
Motif
Other DBs
NCBI-GeneID: 4562246
NCBI-ProteinID: XP_001243278
UniProt: J3K9S3
AA seq 657 aa AA seqDB search
MGSQEKILPQKGQRNILVTSALPYVNNVPHLGNIVGSVLSADVFARYHKACGRPTLYVCG
TDEYGTATETKALEEGVTPEELCAKYNKIHQEVYEWFEIGFDFFGRTPTQKHTEISQSIF
KRLYKNGYLEEKTAEQPFCEKHQSFLADRYVEGECPRCHYDDARGDQCDKCGSLLDPFDL
INPRCKVDGATPVSRPTKHIHLLLDKLQPQIEDWVRPAIEKGDWPKNSRVITESWLKEGL
KDRGITRDLKWGVPVPLEGYDNKVLYVWFEACIGYPSITANYTDDWELWWRNPEDVRLYQ
FLGKDNVPFHAVIFPGCQLGTKDNWTMLHHLSTTEYLNYENGKFSKSRGIGVFGNNAKDT
GIPPDVWRYYLLKNRPETGDTQFEWRSFIDANNGELLAKLGNLVNRVVKLIASPKAYSSV
VPDFTIPESFNPVLDDVTAILRQYIEEMEGVHLRAGLITAMRVAEAGNNLIQSNKLDNSL
IANEPERAATVVGIVTNLIHLCASVFSPYLPATSKSILEQLNAPFKNIPSLEDLKDGWKP
TAIKAGHKIGKAKYLFSNIDVKKADEWREMFGGSQAERRKKEEEAAKVAAKKAANKAKKK
EKKKQPKGDKEDERVGKNVETSAKGGAEAVSATAEDKKGEAVEKITDGVAQVTIPTS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccaagagaaaatcctgccccagaagggccaacggaatattctcgttaccagc
gccttgccttacgtaaataacgttccccatctcggaaacattgtgggctccgttcttagt
gccgatgtctttgctagatatcacaaagcctgtggcagaccgactctatacgtctgcgga
actgacgaatatggcacggcgacggaaaccaaggcgctcgaagaaggtgtgacgcccgag
gagctatgcgccaaatacaacaaaattcaccaggaagtttatgaatggttcgagatcggg
tttgactttttcggccggactccaacgcaaaagcataccgaaatatcgcagagcattttt
aagcgactctacaagaatggatacctggaggagaagaccgcggaacagccattttgcgaa
aagcaccaatcctttttagcagaccgatatgtggagggcgaatgcccccggtgccactac
gatgatgccagaggagaccagtgcgataaatgcggctctctcctggatcctttcgatttg
attaatccccgttgtaaggtcgacggcgcgacaccagttagccgtccaacgaaacatatt
catcttctattggataaacttcagccgcagattgaagattgggttcgccccgctatagag
aaaggagactggccgaaaaacagtcgagtcattaccgaatcatggctgaaggagggcctc
aaagatcgtggcattacgcgagatttaaaatggggtgtaccggttcctctcgaaggctat
gacaacaaagttctttacgtctggttcgaggcttgtattggatatccttccataacggcc
aactacaccgatgattgggagctctggtggagaaatccagaggacgtccgattataccag
ttcctcggaaaagataatgtacccttccacgctgtcatttttcccggctgccagttagga
acaaaggacaattggaccatgttgcaccaccttagcaccaccgaatatcttaactatgag
aacggcaagttcagcaaatcccgcggtatcggtgtctttggaaacaatgccaaggacact
ggcattcccccagatgtgtggagatactaccttctcaagaaccgaccagaaactggcgat
acccaatttgaatggcgttccttcatcgatgccaacaatggagagcttcttgcgaaactg
ggaaacctcgtaaatcgagttgtcaaactgatagcgagtcccaaagcttacagcagcgtt
gtgcctgattttaccattccggaatcattcaaccccgttctagatgacgtaacagccatt
ctccgtcagtacattgaagaaatggaaggggttcaccttcgtgctgggctcatcaccgct
atgagggtcgctgaagccggcaacaacctcattcaatcaaacaaactcgacaattctctc
attgccaacgaaccagaacgggctgccaccgtggtcggcatagtgactaacttaattcac
ctttgtgccagcgtcttctctccgtacctccccgcaacatcaaagtccattctcgaacaa
ctaaatgctccattcaaaaatatcccatccctagaagacctcaaggacggttggaagcct
actgccatcaaggctggccataagattggcaaagcaaagtatctcttctctaacatcgac
gtcaagaaggctgatgaatggcgggaaatgtttggtggttcccaggccgaaaggcgaaag
aaggaggaagaagctgccaaagtggccgcaaaaaaggccgcaaacaaggctaaaaagaag
gagaagaagaagcagcccaagggagataaagaggatgaacgcgtgggaaagaatgtggag
acctctgcaaagggaggtgcagaagctgtttctgcaacagcagaagacaagaagggtgaa
gcggtggagaagattactgatggcgttgcccaagtcacgattcccacatcttaa

DBGET integrated database retrieval system