KEGG   Coccidioides immitis: CIMG_07197Help
Entry
CIMG_07197        CDS       T01114                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cim  Coccidioides immitis
Pathway
cim00230  Purine metabolism
cim01100  Metabolic pathways
Module
cim_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CIMG_07197
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CIMG_07197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_16 AAA_18 AAA_24 AAA_33 AAA_22 ABC_tran AAA_28 RNA_helicase AAA_29 RsgA_GTPase Roc T2SSE AAA AAA_14 AAA_30 NTPase_1 AAA_5 DUF2075 Rad17 NACHT Gtr1_RagA Ras Pox_A32 Cytidylate_kin AAA_19 AAA_23
Motif
Other DBs
NCBI-GeneID: 4562251
NCBI-ProteinID: XP_001243301
UniProt: J3K9U1
AA seq 203 aa AA seqDB search
MFVPCRIAVRKFRPVVISGPSGTGKSTILKRLFAEFPDKFSFSVSHTTRGPRAGEVDGRE
YYFTSKEAFLNLVDEGGFIEYAQFGGNYYGTSTMAVKNISEKGRVCILDIEMEGVKQVKK
TDLNARFLFLAPPSIEELERRLRGRGTETEDSLSKRLAQASNELEYAKQPGAHDKIVVND
DFDIAYKSVRDWIVDNGNFGATL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgccctgccgcattgcagtgcgcaagtttcgccctgtggtgatttccgggcca
tcagggacgggcaagtccacgatccttaagcggctctttgccgagtttcctgataagttc
agcttctcggtatctcataccactcgaggccctcgtgctggcgaagtcgatggtcgcgaa
tactactttacaagcaaggaagcctttttaaatcttgttgacgaaggcggctttatcgaa
tatgctcaattcggtggcaattactatggaacgagcaccatggcggtgaaaaatattagt
gaaaaagggagggtttgtatattggatattgaaatggagggagtcaagcaagtcaaaaag
accgaccttaatgcccggttcctattcctcgcccctccatctatcgaagaactagagcgc
agactccgtggccgcggaacagagacggaagatagcctcagtaaacggttggcgcaagca
agcaatgagctagaatatgccaagcagccgggagctcatgacaaaatcgtagtcaatgat
gattttgacatagcttacaagagtgtgagagattggatcgtggacaatggcaattttggc
gcaacactttga

DBGET integrated database retrieval system