KEGG   Coccidioides immitis: CIMG_07858Help
Entry
CIMG_07858        CDS       T01114                                 

Definition
(RefSeq) biotin-[acetyl-CoA-carboxylase] ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
cim  Coccidioides immitis
Pathway
cim00780  Biotin metabolism
cim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CIMG_07858
Enzymes [BR:cim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     CIMG_07858
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     CIMG_07858
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     CIMG_07858
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     CIMG_07858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 4560476
NCBI-ProteinID: XP_001240695
UniProt: A0A0E1S0Y9
AA seq 709 aa AA seqDB search
MAATSTTTSTKRLNILVYSGNGTTVDSVRQCLFSLRRLLAPNYAVIPVTGEMIINEPWTS
SCALFVMPGGADLPYCRTLNGTGNRRISQFVHRGGAYLGFCAGGYYGSKRCEFEVRNEKL
EVVGDRELAFYPGICRGCAFPGFVYNSEDGARASELQVSKSSFPDEKHIPPSFKSYYNGG
GVFVDAPKFAHQGVEVLADYTESLKVDSGEGHAAVVYCRVGEGAAVLTGPHPEFVSLNAN
VSVDRPQLTALRFAASNLDRNADGPEFCHVIDTLAQNDEARTEFLRACLKKLGLHVNDET
TRVPPLSRMHLSALEPHAATDLVSLLRDIITVEDGEEYIKDDNDTFHLEKPSSLSMDKVA
EALPGSIEAKADQDSTGDRIVDYDKVIKKVAIHEDYPSPVETPRFNHQTFYGMIKEYRSQ
SRERLSEFGSHVLYAEVVTSTNTLLEKNTQILRRLPNGFMATANVQVAGRGRGSNVWVSP
PGQLMFSICIRHPVEKFASAPVVFIQYLVAMAIVKGIKTYDKGYENMPVKLKWPNDIYAL
DPSQPDKMTYTKIAGILVNAHFSSKEYIAVAGAGINALNALPTTSLNAILATLNSSLPAN
KPRLPPLSLEKLLARILTTLEELYTRFLRTGFDQTFEDMYYADWLHMDQIVTLEAEGDVR
ARIKGITRDYGLLVAEELGWEDRPTGRRWELQSDSNSFDFFKGLVKRKI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccgccacctcgacgaccacttcgaccaaacggctcaacatcctggtctattccggg
aatgggaccactgtggattctgtccgccaatgtctgttttcacttcgtcgccttttggca
ccgaattatgctgttatacccgtgacgggtgagatgatcatcaatgagccatggacgtcg
agctgtgctctctttgtcatgcctggtggtgccgatctgccgtattgcaggaccctgaac
ggcactgggaaccggcggattagccagttcgttcatcgaggcggcgcatatctaggattc
tgcgcaggcggctactatggaagtaagcgttgcgagtttgaagtcagaaatgagaagctc
gaggttgtcggtgatagggagttggctttctatcccggaatctgtcgcggttgcgcattt
ccagggtttgtctacaatagcgaggatggcgccagagcttctgagttacaagtgtcgaaa
tcctcgttccctgacgaaaaacatatcccgccctcgttcaagtcctactataacggtgga
ggcgtcttcgttgatgctccaaaattcgcccatcaaggcgtcgaggtccttgcggactac
actgaatcgctcaaagtcgattcgggagaaggccatgcagcagtcgtttattgccgggtc
ggcgaaggtgctgccgtattaacaggaccacacccagagtttgtatccttaaatgccaat
gtttccgtggataggcctcaactaaccgctcttagatttgcggcgtccaacttggataga
aacgcagatggcccggaattctgccacgtcattgatactctagctcagaatgatgaagcg
agaaccgaattcctgcgagcttgtctgaagaagcttgggctccatgtgaacgatgaaaca
acaagggtacctcctctttctcgaatgcatctttctgccctggagccacatgctgctacg
gaccttgtctcactgcttcgagatattatcacggtggaagatggggaagagtacattaaa
gatgacaatgacaccttccatctagaaaaaccgtcttcgctgagtatggacaaggttgcc
gaagcgctccccggctccatcgaagcaaaggctgaccaggactcgacgggtgatagaatt
gtcgactatgacaaggttataaaaaaagtcgctattcatgaagattatccctctccggtc
gaaaccccgcgatttaaccatcagactttctacggtatgattaaggaatatagatcgcag
tcgagggaacgtctctcggagttcggttcgcacgtcttatatgcggaagttgttacgagt
acgaacactttactggagaagaacacacaaatcctgcgaagacttccaaacgggtttatg
gcaacggcaaatgtccaagtcgctggtcgcggtcgcggctccaacgtctgggtgtctcca
ccgggacagctcatgttttcaatatgcatccgtcatccagttgagaaattcgcaagtgct
ccagtcgttttcatccaatatctcgtcgcaatggccatcgtcaaaggcatcaaaacctac
gataagggatacgaaaacatgcccgtgaaactaaaatggccaaacgacatctacgctctc
gacccctcccaacctgacaaaatgacctacaccaaaatcgccggcatcctagtcaacgcc
cacttctcctccaaagaatacatcgccgtcgccggtgccggcatcaacgccctcaacgcg
ctcccaaccacgtctcttaacgccatcctcgccaccctcaactcttctctccccgccaac
aaaccccgcctccccccgctctccctcgagaaactcctcgcacgcatcctcactaccctg
gaagagctctacacccgcttccttcgcaccggcttcgaccagacctttgaagatatgtac
tacgcggactggctgcatatggatcagatagtgacgctggaggctgaaggggatgtgcgg
gcgaggatcaaggggattacgagggattatgggttgttggtggcggaggagttagggtgg
gaggatcggccgacggggagaaggtgggagctgcagagtgatagtaatagctttgatttt
ttcaaggggttggtgaagaggaagatttaa

DBGET integrated database retrieval system