KEGG   Coccidioides immitis: CIMG_08453Help
Entry
CIMG_08453        CDS       T01114                                 

Definition
(RefSeq) aromatic-L-amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cim  Coccidioides immitis
Pathway
cim00350  Tyrosine metabolism
cim00360  Phenylalanine metabolism
cim00380  Tryptophan metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CIMG_08453
   00360 Phenylalanine metabolism
    CIMG_08453
   00380 Tryptophan metabolism
    CIMG_08453
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    CIMG_08453
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cim04147]
    CIMG_08453
Enzymes [BR:cim01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CIMG_08453
    4.1.1.105  L-tryptophan decarboxylase
     CIMG_08453
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_08453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 4559926
NCBI-ProteinID: XP_001241290
UniProt: J3K5I9
AA seq 547 aa AA seqDB search
MLRPNILPRSIRHRLFRHSSPYRLFSSTRCVFNMDAEQFRQAAQSAIEEIIEHFNTLPSR
RVLPNIEPGYLRPLLPQSPPKEPESWEQIQLDIESKIKPGLTHWQSPHFMAFFPALVTYP
SILGEMYSAAFSAPAFNWLCSPACTELEIVVLDWVAQAIGLPECFHSTGPTKGGGVIQGS
ASEAVVTVMVAARERMLRDLAAAEGLKEDTPEWEDKVMSIRGNLVALGSDQAHSCTAKGA
RIVGTRYRSVPTALSDNFEVTGASLRRVLEECEAAGLVPYYLTTTLGTTSTCATDRFAEI
KAVLASKPSWQKIWVHIDAAYAGAALVTPEYQPIAREWDSGIDSFNFNMHKWLLVNFDAS
CLFVRNRTDVTSAMDITPAYLRNPYSELPDTVDFRNWQIPLGRRFRALKIWFVMRAYGLS
GMRAFIYKGLHHGDVFVELCRGRKDLFTIVTPPAFGLTVFRVTDEAAAAACGSTSAAITR
EVYEKINAGGEIFITSSVVGGIYVIRVVSGSWLSEEKYVRRAFDIIAKTTEETLAGKKTN
GVETLKN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtccaaacatcctgccccggagcatccgtcatcggctttttagacactcgtct
ccttaccgtttatttagcagcacgcgctgtgtgttcaacatggacgcagaacagttccgg
caggctgcccagtcagccattgaagaaataatcgaacatttcaataccctcccctcccgc
cgggttcttccaaacattgaaccgggatacctccgcccacttcttccgcagtcccccccg
aaagaacctgaatcatgggaacagatacagctggatatcgaatccaaaattaagcctggc
ctgacgcactggcagtccccgcacttcatggccttctttccggcgctggtgacttaccct
agtatcctgggcgaaatgtattccgcagcgttcagcgcccccgctttcaactggctgtgc
tctcccgcctgcacagagctggagatcgtggtgttggattgggtcgcgcaggccattgga
ctgccagaatgcttccacagcactggcccaaccaagggcggtggtgtcattcagggtagc
gcgagcgaggctgttgtcacagtcatggtcgccgcgagggagcggatgcttcgcgatctc
gctgcagccgagggactgaaggaagacacgcccgaatgggaggataaagttatgtctatc
cgcggcaacctcgtcgcgcttggtagcgaccaggcacatagctgcaccgcaaaaggcgct
cgtatcgtcggcacccgctaccgttccgtccccacggcgctttccgacaactttgaagtg
actggagcctcgctccgcagggtcctcgaagaatgtgaagctgccgggctagtcccctat
tatctcaccaccaccctcggaacgaccagcacatgtgccactgaccgtttcgccgagatc
aaagccgttctcgcgtccaaaccttcctggcaaaagatatgggtacacatcgacgcagcc
tacgccggagccgcgctcgtgacgccagaataccagccaatcgcacgtgaatgggattcc
ggcatcgacagcttcaacttcaacatgcacaaatggctcctcgtcaattttgacgccagc
tgcctattcgtccgcaacaggaccgacgtcacttccgccatggacatcacgcccgcgtac
ctacgcaacccttactccgagctcccggacaccgtcgattttcgaaactggcagatcccg
ctgggccgacggttccgcgccctgaagatctggttcgtcatgcgcgcatatgggctgtcc
gggatgagggcgtttatctacaagggcttacatcacggcgatgtctttgtggagctgtgc
cgcggcaggaaggatttgttcacaatagtcacgccaccagcgttcgggctgactgtcttc
cgcgtcacggatgaagcggcggcggcggcgtgtggaagtaccagtgcggcgattacgcgt
gaggtctatgaaaagatcaacgcgggcggtgagatattcatcacgtcttcggtggttgga
gggatatatgtgattcgcgtcgtgagcgggtcgtggttgtcggaagagaagtatgtgcgg
agggcgttcgatatcattgcgaagacaacagaggagactctcgcgggaaagaagaccaat
ggggtcgagactctgaaaaattga

DBGET integrated database retrieval system