KEGG   Coccidioides immitis: CIMG_08569
Entry
CIMG_08569        CDS       T01114                                 

Definition
(RefSeq) polyketide synthase
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
cim  Coccidioides immitis
Pathway
cim00254  Aflatoxin biosynthesis
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CIMG_08569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:cim01008]
    CIMG_08569
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     CIMG_08569
Polyketide biosynthesis proteins [BR:cim01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    CIMG_08569
SSDB
Motif
Pfam: ketoacyl-synt SAT Acyl_transf_1 Ketoacyl-synt_C Thioesterase PP-binding PS-DH KAsynt_C_assoc Thiolase_N Abhydrolase_1
Other DBs
NCBI-GeneID: 4560577
NCBI-ProteinID: XP_001241406
UniProt: A0A0E1RVE4
AA seq 2258 aa
MAQDMQVFLFGDQTYDLVPDLRQLLRCNTKPILSAFLEQSHYVIRAQSATWLSPEEQQRS
RSSNLAHLLQKYSDGDLNPAFQVALHSLTQLACFINHYEEPGRPYPSPGRKYVVGLCTGA
LAAAAISSSSSLSELLPAAVHTVQVALRLGLLANDMKDRIETPTQESPREWSAAFFDMTE
AAAVSALVEFDSVTPVPCKLRPWIGATSSKAITISGPPSVLRRLIKGRALGQYKSRTLPI
FLPSHTPQLFSIQDVEKVLEATNPVTWSRYNAKLPVLSGATGKSDWGGSFVSLLHRAVRE
CLMEPVRWDGVSDSVTKIARSLEVKCVAVTPVGTNLEHSMSSSLKDITKVQIEPLKSSDS
PLFDTVPVGKAKLAIVGMSGRFPEAPTPEAFWDLLYEGLDVCKEVPAKRWDWRTHVTPDG
KGHNLGGSKWGCWLDYADQFDPRFFSISPKEAPQMDPAQRMALMTTWEALEQSGFVSNTT
PSTQNDRVGVFHGVTSNDYLECNSGQYIDTYFITGGNRGFIPGRINFCFEFCGPSYTNDT
ACSSSLAAIHLACNSLWRGDCDTAVAGGTNMCINPDGHTGLDKGFFLSRTGNCKPFDDQA
DGYCRGEGVATVIIKRLDDAIAENDPILAVILDAKTNHSALSESMTRPHVGAQVENMRAV
LNTSGLDPRELSYVEMHGTGTQVGDAVEMQSVLNVFAPDNEFRGRDKPLYVGSAKANVGH
GEGVSGITSLAKVLLMMKHDTIPPHCGIKPGSRINRNYPDLKARNVHIASEPVPWTRGSE
PRRVLINNFSAAGGNTALLLEDAPLKPVLADKDPRSSHIVTVSGHVVASLKENAQRLIDF
IGKSGSNEYSLSQLSWTTTARRAHHLFKIAVAGSTPMEVRQRLQEALASGDGTTRPKNKP
KILFAFTGQGSQYIGMAKSLFHAFPSFRSDICNFDRLAHHTMGFPSFLHIITSNTGDMND
QSPVVVQLAIVSLEIALARLLQSLGVVPSAVVGHSLGEYAALHIAGVMTLFDTLYLVGRR
AEFIQELCDRGTQAMLAIKASHSTIRKLLNGKAYEVACVNGPEDTVISAANDVIDGAKAV
LNHNGIKSTVLQTPFAFHSAQVAPIMDLYTKTAEGVTFHKPSVPVLCPLTGKVVQEEGVF
SAHYLVRHLREPVNMAAALGTAYESRVLDDSTFTIEIGPHPVVCGMVKATLGSQMPTLAI
LSRGKDVWPLMTEALAALYRQGYNIIWGVYHAPFKSSHRVVELPAYGWDLKEYWIPYEND
WCIYKPYGRPGYAGHKAQSGNPIVLVDEPQSKTLPAPSVSIRKPQTTTIQTMISEDIHNT
GATLVYEMDLNRPDASNVAGGHIVSNIPFTTPSVFADMAFVLGKYVVERFFKRPTVIDVA
NIVADKVLIPRGNGPQPIRVSMTMTWEPGQPQTLQAAQCEFYSVDAKGKTTARHSWCTVY
FHDGTQRKKLASEVPLILSRIQRLRDGVDNGQFVRYNRASGYRLMSSVAHFHPDYKVLDD
MVMDDETLEATCTLNFGLLSSGGCFAAHPAFVDCMTQLGGFTVNAQESLDLSAEVYISHG
WDSLQIYDSFKAERKYQLYAQMKRDGSEFYHGDTCLLDGSTIIAYFKNVTVRRVSRKIHR
AVMQTLVQRNTNAAASKGSADHKAAVHSPPVPKKPIAVSASKALPAVPSPTPKKAAELSA
PKAMPAAAPLPVPLVAKTRNKKPAPQDTISEPQKKARNVPTEQRTISAGGARAKQKIAEC
LQVIAEESGIAVDDLTDDSNFADIGVDSLLSMVIASRFRENLGLDLDANFALFAECPTVK
KLKEFIANFLGEPLETQASQLRDDNDERLQEIPPPDTKAMLDTSYSTPLEPIPAESSSSA
PSTGHTSETLVEMPSFIKEDDSFLGVRAGGICSAGLAIVSEESGIAISDLTDETNFADIG
VDSLLSMVIGSRFREELGLDLGADFSIFVNCPTVKKLKVFLNSHDASSEDDGSSDDAFGS
STSVSSMEEYADTKKAEFTQLLDDDCRPATSVILQGIPKLARKTLFLLPDGSGSASSYVP
IPKLNRDVAIVGLNCPYVRDPENMNCTHTALLSSYYNEIRRRQPKGPYHLGGWSAGGGFA
FACAELLIRDGEEVQSLIIIDSPLPQQMETLPVEFYEHCATLGLYGNEKPPSYLIPHFLR
TLETMLPYQATPLKTRRLPKVGILWACETVMDAAGAPDIGERNHFMLRRRQDFGPDGWDT
VLPGAEFVLGKAVGANHFTMMQKDHNQHIARLIEKVVG
NT seq 6777 nt   +upstreamnt  +downstreamnt
atggctcaggacatgcaggtcttcctctttggagaccaaacatatgatctcgtacctgat
cttcgacagctactacgctgcaatacaaagccaattctcagtgcctttttggaacaatct
cactatgtgatccgagcccaatctgctacttggctgtctccggaggagcaacagaggtcg
agaagttcgaacctcgcccatcttttgcagaagtattccgacggtgatttaaaccctgca
ttccaggtggctctgcattcattgacgcagctggcctgctttattaatcattatgaggag
cccggacgtccgtatccaagccctggccgaaaatatgttgtcggcctctgcactggtgct
ttggcggcagccgctatcagttcctccagctctctttccgaactactacccgcagcagtc
cacacagtccaagttgccctgcgcctcggcttgctcgctaatgacatgaaagaccgtatc
gaaacacccacgcaagagtctcctcgagagtggtccgccgcgttctttgacatgactgaa
gccgcagctgtgtccgctcttgtagagtttgatagcgtaacgccggtcccgtgcaagcta
cgcccgtggattggagcgacatcttcaaaggcgattacaattagtggtccgccgtctgtt
ctgcgacgtctcattaaaggtcgggctcttggacaatataaatccagaactctccccatc
ttccttccctcccatactcctcaactattttccatccaggatgtggaaaaagttcttgaa
gccacaaatcccgtaacatggtctagatataacgctaaattgcctgtgctatcgggcgcc
acggggaagtccgactggggaggcagctttgtgtcccttctccaccgagcagtgcgtgaa
tgcctcatggagcctgttcgatgggacggggtgtccgacagcgtgaccaagatcgctcga
tcgctagaagtaaagtgcgtggctgtcactccggttggaacgaatctcgaacacagcatg
tcatcttctctgaaagatattacaaaggtacagatcgagccgctcaaaagctcagactca
cccttattcgacaccgtacccgtgggaaaggcaaagctggccattgtcgggatgtctggt
cgcttcccggaagccccaactccggaagcattttgggatcttctgtatgagggcttggat
gtctgtaaagaagtcccggccaagcgatgggattggcgcactcacgttactccagacggc
aaaggccataatctagggggttcaaagtggggatgttggctcgattacgcggaccagttt
gatccccgttttttcagcatttccccgaaggaagcgccccagatggaccctgcgcaacgt
atggcactaatgactacatgggaggctctcgaacagtctggattcgtatccaatactacc
ccttcgacccagaatgatcgagtcggagtattccatggcgttaccagtaatgattacttg
gaatgcaatagcggccagtacattgacacgtatttcatcactggcggcaatcgtggattt
atccctggcagaatcaacttttgctttgaattctgtggacccagttacacgaacgacacg
gcatgttcttcgagcttggctgctattcatctagcctgtaactccctttggcgaggagac
tgcgatacagccgttgcgggagggactaacatgtgcatcaatccagacgggcacacaggt
ttagataaaggatttttcctgtcccgaacaggcaactgcaaaccgtttgatgaccaggca
gatggatactgccgcggtgaaggggtagcgactgtgattatcaagcggttggatgacgcg
attgccgagaacgacccaatcttagccgtcattcttgatgccaaaacgaaccactcagcg
ctgtcggagtcaatgacgcgaccccatgtgggagcacaggttgagaacatgcgtgcggtg
ctcaacacttcagggctagatccaagggagctgagctacgttgaaatgcatgggacaggg
acccaagtcggcgatgcggttgaaatgcaatctgttctgaatgtcttcgctcctgacaac
gagttccgagggcgcgacaagcctttgtatgtgggatctgcaaaagcaaacgttgggcac
ggggagggagtgtctgggattacgagtctggctaaagtgcttttgatgatgaagcatgac
accatcccaccccattgtggaatcaagcctggtagcaggatcaatcgcaactacccagac
ctgaaagcccgaaatgtgcatattgcttccgaacctgtgccttggactcggggttctgag
ccacgccgagtcttgatcaataacttcagtgcggcgggaggcaacactgctcttctcctt
gaagatgcgcccctaaaacctgtgctagctgacaaagaccctcgcagcagccacattgtg
acggtctccggacatgttgttgcttccctaaaggagaatgcccaacggttaatcgacttt
attgggaagagcgggtcaaatgagtactcactctcccagctttcctggaccacaaccgca
agacgcgctcatcacctgttcaaaattgcagtggctggttccaccccaatggaggtcagg
caacgtctgcaggaagccctcgctagcggggacggaactacaaggcctaagaataaaccc
aaaatactatttgcgttcactgggcagggctctcaatacatcggcatggcaaaaagtcta
ttccatgccttcccgagtttccgatcagatatctgcaattttgaccgactagctcaccat
accatgggctttccttcgtttctccatattatcacatcgaacactggagacatgaatgac
cagtcaccggtagtggttcagcttgcaattgtatcattggaaattgctcttgcacggctt
ttgcagtctcttggggtggttcccagtgccgttgttggccatagcttgggagagtatgcc
gcactccacatcgcaggtgtcatgactctgtttgatactctgtatttggttggccgccga
gccgagttcattcaggagctatgcgatcgtggaactcaggcgatgcttgcaattaaagcc
tcacattcaactatcagaaaactcctcaacggcaaagcgtacgaggttgcatgcgttaat
gggcccgaggataccgtcattagcgcagccaatgatgtaattgatggtgccaaagcggtg
ctcaatcacaatggtattaagagcacggttctgcagacgccttttgcattccattccgcc
caggttgcacctattatggacctctacaccaaaacagcggaaggtgttacctttcacaag
ccatctgtaccggtactatgtccgctcaccggcaaggtggtccaagaagaaggggtgttc
agtgcccattatctggttcgccatctccgtgaaccggtgaatatggcagctgctcttggg
actgcctatgaatctcgggtattagatgacagtactttcactatcgagataggccctcat
cctgttgtgtgtggtatggttaaagcgaccctcgggtctcagatgccaacattagccata
ctctcacgtggaaaggatgtatggccattgatgactgaagctctggcagcactttacagg
caagggtataacatcatatggggggtctatcatgctcctttcaaatcctcccatcgggtt
gtcgaacttccagcctatggatgggatttgaaggaatattggattccatacgagaacgac
tggtgcatatataagccgtacggccgacccggttatgctggccataaagctcagtccggc
aatccaatcgtacttgtggatgagccgcagtcaaagactctccccgctccgtctgtgtcc
atacggaaacctcagacaacaacaatacagacaatgatttccgaagatattcataataca
ggagctactctagtgtatgagatggacttgaaccgacctgatgcaagcaatgttgctggt
ggtcacattgttagcaacattccattcaccacgccatccgtctttgcagatatggcattt
gtgcttgggaaatatgttgtggaacgcttcttcaagcgtcccaccgtcattgatgtggcc
aatattgtggcagacaaggtcttgatcccgcgcgggaatggaccccaacctatccgggtg
tcaatgacaatgacatgggaaccgggtcaaccgcagactttgcaagcagcgcaatgcgaa
ttttacagtgtagatgccaagggaaaaacgacagctcgacactcgtggtgcactgtctac
ttccatgatggtacccaaagaaagaagcttgccagtgaagttccacttatcctatccaga
atccaacgcctccgcgatggcgtagacaatggacagtttgtgagatacaatcgagcaagc
gggtacagactgatgagttctgttgcacacttccacccagactacaaagttttagatgat
atggttatggatgatgagacgctcgaggcgacctgcacgctcaatttcggattgctttca
tccggagggtgcttcgcagcacatcctgcattcgttgattgcatgacacagttgggtgga
tttactgtcaatgcacaagagagcctagacttatctgccgaggtctacattagccatgga
tgggactcactccaaatctacgacagctttaaggctgaaagaaagtatcaactttacgcc
cagatgaagcgggacggaagcgagttctaccacggcgatacctgccttctagatggaagc
accattatagcgtacttcaagaatgtcacagtccgacgagtctcgaggaaaatccaccgc
gccgttatgcagactctcgtgcagcgtaataccaatgcagcagcatcaaagggttcggct
gaccacaaggctgctgttcatagcccccctgtgccgaaaaagcccattgcggtttctgca
tcgaaggccctgccagcggtgccatcacctacgcccaaaaaggctgctgagttgtccgcg
ccaaaggccatgccagcagctgctccattgcctgtaccattagtggccaagacaagaaat
aaaaaacctgcgccacaagataccatttcagaaccccagaagaaggcaagaaatgttcca
acagagcagagaaccatttcagcgggtggcgcccgtgcgaagcagaagatcgcggagtgt
ctgcaggtaattgcagaagaaagtggcatcgctgtggacgatcttaccgacgatagcaac
tttgccgatatcggtgtcgactcactgttgtcaatggtcattgccagccgcttccgtgaa
aacctcggtctagacctcgatgccaactttgcattattcgctgaatgccccacggtcaag
aaactcaaggaattcattgcaaatttccttggtgagcccttggaaacacaagcgtcacag
ctgcgggacgataatgatgagcggctgcaggagattccaccaccggatacgaaggcaatg
ctagatactagctatagtacgccgctggaaccgattcccgcagagtcctcatccagcgct
ccatccacgggccatacatctgaaacattggttgaaatgccctcgttcatcaaggaggac
gattcttttttaggagttcgagccggcggaatatgctccgctggtttagcgatcgtgtcc
gaagaaagcggcatcgcaatttccgaccttactgacgaaacaaactttgcggacattgga
gtagactcccttttatccatggtcattggcagtcggttccgtgaggagctcggtttggac
ttgggtgctgacttctccatttttgtgaattgccctacagtgaagaagctcaaggtattt
ttaaatagccacgatgcatccagcgaagatgatggatcgtcagatgatgcgtttggctcg
tctacttctgtatcaagcatggaggaatatgccgataccaagaaagcggagttcactcag
ttgctcgacgacgactgccgaccagcaacatccgttatccttcagggtattccgaaattg
gcccgcaagactcttttcttactcccagacggaagtggctcagcatcgtcatacgtgcca
attccaaagcttaatagggatgttgctattgtcggtctcaactgcccttatgtccgcgac
cccgagaacatgaactgcactcacaccgcccttctatcaagctactacaacgaaatccga
cgacggcaacccaagggcccctaccacctaggcggctggtccgctggtggaggttttgcc
ttcgcatgcgccgagctccttatccgcgacggtgaggaggtgcagagcttgatcattatc
gactctcctctcccccaacagatggagacccttcctgtcgaattttatgagcactgtgct
actcttggattgtacggtaatgagaaaccccccagctatctcattcctcatttccttcgc
accctggagaccatgcttccgtaccaggcaacacctttgaaaaccagaaggttgcctaag
gttggaatcctgtgggcctgcgagacggttatggatgctgccggcgcgcctgatattggc
gagagaaaccatttcatgctgcgacggaggcaggattttgggcccgatggatgggacaca
gtcctcccaggggcggaatttgtgctaggcaaagctgtcggcgcgaatcactttacaatg
atgcaaaaggatcataaccaacatattgcacgattgattgagaaagtcgtaggttag

DBGET integrated database retrieval system