KEGG   Coccidioides immitis: CIMG_09051Help
Entry
CIMG_09051        CDS       T01114                                 

Definition
(RefSeq) alternative NADH-dehydrogenase
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CIMG_09051
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     CIMG_09051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 4558271
NCBI-ProteinID: XP_001239430
UniProt: A0A0E1RVR7
AA seq 579 aa AA seqDB search
MVNSKVLARPALQLSIAASRRPLPTVSQRQFAQLTRPVIRTRRGVIEHSAPRRTNATAAS
PSPAPKPKKRAGFFRWSYRLFLLSLVGGVGALGHSIYLLRHPAEQFAPDPEKKTLVILGT
GWGSVSLLKKLDTANYNVVVISPRNFFLFTPLLPSCTTGLIEHRSIMEPVRNILRHKSAT
VKYYEAKATKIDYERKVVQISDESEIKGDTSQTEVPFDMLVVGVGAANATFGIPGVKEHS
CFLKEVGDAQKIRTRIMDCVETAIFKDQTPEEVKRLLHMVVVGGGPTGVEFAGELQDFFN
EDLKKWIPDIKDNFHVTLVEALPNVLPMFSKQLIDYTESTFKEEAITIRTKTMVKNVTDK
YIEAEVTNPDGSKEMEKIPYGLLVWATGNAVRPVVKDLMSQIPAQKISRRGLAVNEYLVV
NGTENIWAVGDCAITNYAPTAQVASQEGAFLARLFNTMAKTEAIEKDLKKLSVAQYEAKD
DEKRNQLLDEIRALQKQLRRTKQIGPFQYSHQGSLAYIGKERAVADISWLSGNIASGGTL
TYLFWRSAYLSMCFSTRNRVLVALDWVKARLFGRDVSRE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtcaattcaaaggtgctggcccggccagcattgcagctgtcaatcgctgcttctcgc
cgacctttaccgaccgtctcccaaagacaattcgcccaattgacacgtcccgtaatacgg
actcgccgcggagtaatcgagcactctgcccctcgtcggaccaatgccaccgccgcctct
ccgtcacctgcaccaaaaccaaagaagagagctgggttcttcagatggtcatatcggtta
ttcctgctatcgctggtgggcggagtgggcgcattgggacacagtatctatctactgcgt
caccccgccgagcagtttgctccagatccagagaagaagaccctggtgattctgggcacc
ggctggggctcagtttccctcctcaagaagcttgataccgccaactacaatgtcgtcgtc
atttctccgcgcaatttcttcctcttcacccctcttctgccatcgtgtaccaccggtctg
atcgaacatcgctcgatcatggagcctgttcgcaacatcctccggcacaagtccgccact
gtgaaatactacgaggccaaggccacaaagattgattatgagaggaaggtcgtgcagatc
agtgatgaatcggagatcaaaggcgatacttcccagaccgaagtcccgttcgacatgctg
gtcgtgggagtcggtgcagccaatgcgacgttcggtatccctggcgtcaaggagcattct
tgcttcttgaaagaggtgggcgatgcgcagaagattcgcacacgaatcatggactgcgtc
gagaccgctatcttcaaggaccaaacccccgaggaggtcaaacgccttcttcacatggtc
gtcgttggaggcggtccaaccggggttgagttcgccggtgaacttcaggacttcttcaat
gaggatctgaagaagtggattccggacatcaaggataacttccacgtcactttggtcgag
gctttgccaaacgttcttcccatgttctccaagcagcttattgactacaccgaatctaca
ttcaaagaagaggcgatcactattcgcaccaagacaatggtgaagaatgtcacagataag
tacatcgaagccgaggtcaccaatcccgatggttcaaaggaaatggagaagattccgtac
gggctccttgtgtgggctaccggtaatgccgtgcgccccgtcgtcaaggatctgatgagc
caaatccccgcccaaaagatctcccgccgcggtctcgccgttaacgaatatctcgtcgtc
aacggaaccgagaatatctgggccgtcggcgactgcgccataaccaactacgcacccacc
gcccaagtagctagccaggagggcgcattccttgcaaggctcttcaacaccatggccaaa
actgaagccatcgagaaagacctgaagaaactctccgtcgcgcaatacgaagcaaaggac
gacgagaagcgcaaccagctcctcgatgagattcgggcgctgcagaaacagctccgccgc
accaagcagattggcccgttccagtactcccaccagggaagtctagcgtacatcggcaag
gaacgcgccgtcgcggatatcagctggctcagcgggaatatcgctagcggtgggacccta
acgtatcttttctggcgcagcgcctatctgagcatgtgctttagcacgcgcaaccgcgtc
ctcgtcgcactcgactgggtcaaagccagactctttggtcgtgatgtctccagagagtga

DBGET integrated database retrieval system