KEGG   Ciona intestinalis (sea squirt): 100175298Help
Entry
100175298         CDS       T01056                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100175298
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     100175298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 Flavodoxin_NdrI
Motif
Other DBs
NCBI-GeneID: 100175298
NCBI-ProteinID: XP_002130153
Ensembl: ENSCING00000008624
UniProt: F6T1J8
Position
Unknown
AA seq 673 aa AA seqDB search
MDAPVEEAAPFMSTLDLFLLSALVGFGVYWFFFRKDDTPSDDEFKKLSVVQSTLIRSESF
DLGFLARMKKSGRNIAILYGSQTGTAEEFANRLAKDAQRYGMKALVLDPEECNVEDLPQL
TEIQNSFLIFCMATYGEGDPTDNAQDFHDWLKQGDTMLTGIRYAVFGLGNKTYEHYNSMG
KFVDKRVEELGGERLYELGLGDDDTNIEEDFVTWKEGLWPAVCQRFGIEASADDGSFRAY
SFTQYEDGELDKKTIYTGEVARLHSYDNQRPPYDAKNPFLAPVQTNKELHKGGGRSCMHI
EFDITGSRIKYEAGDHVAVYPTNDEAMVEELGERLKTNLDTLFTMNNVDEDSSKRHPFPC
PTTFRTALLHYLDIASPPRTNVLSEFIEYTSDEKDKQFLKLLSSATPEGKKLYQEWVMDS
RRTLLAVLKELPSCCPAMDHICELLPRLQARYYSIASSPRAHPNSIHICAVVVKYKTNAG
YDNFGVATNWLSGKVPATGTAIPRAPIYVRKSQFRLPFKVSHPVVMIGPGTGLAPFIGFI
QDRAYHREQGKDVGKTILYFGCRKRSEDFIYEEMLENWKSEEVLTELNLAFSRDAEKKTY
VQHLIAQNKDSLWEVIEKHGHIYVCGDARHMARDVHDAIVTIVEEKGDKSHQQAIDFVKG
LMNKGRYSADVWS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaccagtagaagaggctgctccttttatgtcaactttagatttatttttactc
tcagctttggtgggatttggggtatattggtttttcttcaggaaagacgacacgccaagc
gatgatgagttcaagaagctgagtgttgtgcaatcaactttaatcagaagcgaatctttt
gaccttggattcctggcacgaatgaaaaaatcgggacgaaacattgcaatcttgtacggg
tcacaaacgggcacggctgaggagtttgccaaccgactcgcgaaagatgcgcaaagatac
gggatgaaagctctcgttttggatccagaagaatgcaatgtagaggatcttccccaatta
actgagatacagaactctttcctaatattctgcatggcaacttatggagagggagacccg
accgataacgcgcaggatttccatgattggctcaagcaaggagataccatgcttactggg
atcagatacgctgtgtttggtttgggcaacaaaacgtacgaacattacaactcaatgggg
aagtttgtggacaagagagttgaggagttggggggggaaagattgtacgaactcgggctc
ggagatgatgatacaaatattgaagaagactttgtgacgtggaaagaaggtttgtggccg
gctgtttgtcaacggtttggaatcgaagcttcagcggatgacggttcgttccgtgcttat
tctttcactcaatacgaagatggagaattggacaagaaaacgatatacacaggagaagtg
gcgaggctgcattcatatgataaccagaggccaccatatgatgcaaagaatccattcctt
gccccagttcaaaccaacaaggagctgcataagggtggtgggcgctcatgcatgcatatt
gagttcgatatcacaggatctcgtatcaagtatgaagctggtgaccatgtggcagtctac
cccaccaatgatgaagctatggtggaagaattaggtgaaagactcaaaacaaacctggat
actttgtttacaatgaataacgtggatgaggattccagtaaacggcatccattcccatgc
cccacaacctttcgtaccgctctgcttcattaccttgacattgccagcccaccccgcacc
aatgtgttgagtgaatttattgaatatacatcggatgagaaagacaaacaatttcttaaa
cttctgtcatctgccacacctgaaggaaagaaactgtaccaggaatgggttatggattct
cgtcgtaccttgttagctgtgttaaaggagcttccatcatgctgtccagccatggaccac
atatgtgaacttctaccacgacttcaagcaagatattactccattgctagctcacccagg
gctcaccccaacagcatccatatatgtgcggttgttgtcaagtacaagacaaacgcaggt
tacgacaacttcggtgtggcaacaaactggctcagtggtaaagtccccgcaacaggaact
gccatacctcgtgccccaatatatgtcagaaagtctcagttccgcctcccgttcaaagtg
agccacccggtggtgatgattggtccggggacgggcctcgctcctttcatcgggttcatc
caggatcgtgcttatcatcgagagcaagggaaggacgtggggaagaccatcctctacttt
ggatgcaggaagagatccgaagatttcatttatgaggagatgctggaaaattggaaatct
gaagaagtgttgaccgaattaaacctcgccttcagtcgcgatgcagagaagaaaacgtac
gtgcaacacttgatagcacagaataaagattccctatgggaagtgattgagaagcatggg
catatctatgtttgtggtgacgcccgtcacatggcacgtgacgtccatgatgccatcgtg
acaattgtcgaggagaaaggtgacaagtcccaccaacaagccatcgactttgttaaaggt
ttgatgaacaagggaagatactctgctgacgtatggagctga

DBGET integrated database retrieval system