KEGG   Ciona intestinalis (sea squirt): 100175498Help
Entry
100175498         CDS       T01056                                 

Definition
(RefSeq) GTP cyclohydrolase 1-like
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00790  Folate biosynthesis
cin01100  Metabolic pathways
Module
cin_M00842  Tetrahydrobiopterin biosynthesis, GTP => BH4
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100175498
Enzymes [BR:cin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100175498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 100175498
NCBI-ProteinID: XP_002122857
Ensembl: ENSCING00000004358
UniProt: A0A1W2W6W5
Position
Un
AA seq 222 aa AA seqDB search
MNTADTVMAAGSKTTSNGFTEFSRPSKNASNQTHGSNQHNRLEGAFRSILEEIGEDVNRQ
GILKTPKRAAEAIKFFTKGYNENLQEIVNEAIFDEDHDDIVIVKDIDMFSMCEHHLVPFT
GKVAIGYIPNKRVLGISKLARIVEMYSRRLQVQERLTKQIASALVEVIEPSGVAVVIEAS
HMCMVMRGVQKPRATTMTSSMFGVFRDDPKTREEFLTLLNKT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgctgatacagtcatggcagcaggttcgaaaaccacatcaaacggtttcact
gaattttccaggccttcaaagaacgcttcaaatcaaactcatggttctaatcaacataac
cgcctcgagggtgcttttcgatcgattttagaagaaattggagaagatgttaacaggcaa
ggaattcttaaaacaccaaaacgagcggcagaagcgattaagttttttacaaaaggttac
aatgaaaatttacaagagatcgttaatgaggcaatatttgacgaggatcatgacgatatt
gtgatcgttaaagacatcgatatgttttcaatgtgtgaacatcacttggtaccgtttact
ggaaaggtggctatcggatacattccaaacaaaagggtgttaggaattagcaagcttgca
agaatcgtggaaatgtacagtcgtcgattgcaggttcaggagaggctaacaaaacaaata
gcgtctgcactcgttgaggttattgaaccttccggggtggctgttgttattgaagcatct
catatgtgtatggtgatgcgaggtgttcagaaaccaagagcaactacaatgactagcagt
atgtttggcgttttccgagacgatccgaaaactcgcgaagaattcctaaccttgctcaac
aaaacctaa

DBGET integrated database retrieval system