KEGG   Ciona intestinalis (sea squirt): 100175499Help
Entry
100175499         CDS       T01056                                 

Definition
(RefSeq) autophagy-related protein 16-1
  KO
K17890  autophagy-related protein 16-1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04136  Autophagy - other
cin04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cin00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100175499
   04136 Autophagy - other
    100175499
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cin04131]
    100175499
   03029 Mitochondrial biogenesis [BR:cin03029]
    100175499
Membrane trafficking [BR:cin04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100175499
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100175499
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100175499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 WEMBL WD40_like Fez1 KASH_CCD Rootletin YabA TSC22 CEP63 Leu_zip Atg14 IL2
Motif
Other DBs
NCBI-GeneID: 100175499
NCBI-ProteinID: XP_002129273
Ensembl: ENSCING00000012347
UniProt: A0A1W2WDD7
Position
Unknown
AA seq 586 aa AA seqDB search
MSVSTDYKVAVLQQIENRNKLYGRFADIINSHNLLHDQNKNLQKENENLKNELEKNRREI
STKAHGTVTGSERSEQVAALEQKLIRIQEELTEVHRTKGARNQQIIDLNFAVQEKEKELI
EVKQTLKDKTDEVNKLNQQTSSLETHISELQQANQTLKDEYQALHITYESVDGKLRQCQM
DNRDLVERWLKFKHKEAESLNSENDNFKRKSDRKVTAGLQEGAVENTQQARKGSDASTSS
NDIHSASPPTFKQKISEFFGVSKKVSIEEETPPSMYGSHHHCMAVVRLPQLALCKWRAHE
SEVTATRFSSSGGILATGGSDRFIHIWNFIGGTDKSRLQYTLRGSNGGITDIDMGPQDQI
LAASSNDYATRIWTIETQRLKLTLTGHGGKVLAARFLGSVHRLASGSNDRTVKVWDVRSG
SCTRTFMAGSSCNDLVSADDADCLASGHFDRKVRIWDARISGHAQNEIVVGGRVTSVDMP
FDKTTLVCCTKDHTLEVIDLRKSAVVSLFSDDRFKVATDQTRCSYSNDGMFVAVGSSDGS
VLTWKVKTGELVSITKEHSDPVISCNWLGGRLVTGDKNKHCILWSE
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcagtacggattataaggtcgctgttttgcagcagattgagaacagaaataaa
ctgtatggtcgattcgctgatattattaactcgcacaatcttctgcatgatcaaaacaag
aatcttcagaaagaaaacgagaatttgaaaaatgaactcgagaaaaatcgtcgcgaaatt
tctaccaaggcccatggaactgttaccgggagcgaacgatccgaacaagttgccgcgttg
gaacaaaaattaataaggattcaggaagaactgaccgaggtccaccgaactaaaggagct
cgcaaccaacaaataattgacctcaactttgcagtgcaagagaaagaaaaggaattgatt
gaagtaaagcaaacgttaaaagataaaactgatgaagtgaataaattaaaccaacaaact
tcttccctcgaaacccacatcagcgaattacagcaggccaaccagacgctgaaggatgag
taccaagctttgcacatcacttacgaatctgttgatggaaaactacggcagtgtcagatg
gacaaccgagatttagtcgaacgttggttgaagtttaaacataaggaagccgagtcgctt
aattccgagaacgataattttaaaagaaaatctgataggaaagttacagcaggattacaa
gaaggtgcggtggaaaacacacagcaagcaaggaaaggttcagatgcttctacctcaagc
aatgatatccattcagcttccccgcctacgtttaaacaaaagatttcagagttttttgga
gtatccaagaaagtttcaatagaagaggaaaccccgccctctatgtatggaagccaccat
cactgtatggctgttgttaggttgccacaacttgctctgtgtaaatggagggcgcatgag
agcgaagtaacagcgacacgtttctcgtcatcgggcggaatattggccaccgggggcagc
gatcgtttcatccatatctggaattttatcggaggaacagacaagagtcgtctacaatat
acactacgtggtagtaacggtggaatcaccgatattgacatgggacctcaggaccaaata
cttgccgcaagttccaatgattacgcaactcgtatttggacgattgaaacacagagatta
aagttgacgttaacgggccacgggggtaaagttctggctgcaaggtttctcgggtccgtt
catcgacttgcttcgggaagtaatgatagaacggttaaggtatgggacgtacgttcaggt
tcgtgtacgcgcacgttcatggcgggctcatcgtgcaacgacctcgtgtcggctgacgac
gctgattgtttggctagcggccattttgatcggaaggttcgaatatgggatgcgagaata
agtggccatgcacagaatgagatcgtggttggggggcgcgtaacatcagtagatatgccg
ttcgataaaactactttggtttgttgcaccaaagaccacacactggaagttattgatttg
aggaaatcagccgtggtcagtttgttcagtgacgatcggttcaaagtagccaccgaccaa
acccgatgctcgtacagcaacgatgggatgtttgtagccgttggttccagtgatggatcc
gtgttgacttggaaggttaagacgggagaacttgtttcaattaccaaggaacacagcgat
ccagttatttcatgcaattggttgggtgggaggcttgtcacaggagacaagaacaagcat
tgtatcttgtggtcggaataa

DBGET integrated database retrieval system