KEGG   Ciona intestinalis (sea squirt): 100175858Help
Entry
100175858         CDS       T01056                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial-like
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00020  Citrate cycle (TCA cycle)
cin00640  Propanoate metabolism
cin01100  Metabolic pathways
cin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100175858
   00640 Propanoate metabolism
    100175858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100175858
Enzymes [BR:cin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100175858
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100175858
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100175858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 100175858
NCBI-ProteinID: XP_002131576
UniProt: A0A1W2WN01
Position
1
AA seq 447 aa AA seqDB search
MSSLVRSLLREQHNIGKLVNASKITGVYAQAKRNLSIHEYLSLGLLKEAGIPTPNGDVAS
TPEEAYNIAKNLSTSDSVVKAQVLAGGRGKGHFTSGLQGGVKIVYSPDEVKEVASQMLGN
KLITKQTGQKGRICNKVLVVERKYVRREFYFAITMERGTKQFGPVLIGSAQGGMDIEAVA
SKTPEAILKEYVDINNGCTEEQAVNLAKRMGFTDSNCHQAADCILKMYKLFIAKDASLIE
INPMAEDSDGNVMCMDAKLNFDDNAAHRQKEIFNLRDWSQEDDRDAQAAKADINYIGLDG
NIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGGGATADQVMEAFKLITSDENVNSILVN
IFGGIMRCDVIAQGIIQAAQQLDLKIPIIVRLQGTKVEDAKALIAQSQLKILTCDSLNEA
AKMVVKLSDIVGLAKEASIDVKFELPI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcattggtccgtagtcttcttcgagagcaacataacatcgggaaacttgttaac
gcatcgaagattactggtgtatatgctcaagctaaacgaaatctttccattcatgagtac
ctcagtcttggtttgctgaaagaagcaggaattccaactcctaatggggatgtagcatcc
acacctgaagaggcatacaacattgccaaaaacttaagcacttcagactctgtggtaaaa
gctcaagttcttgctggaggtcgtggtaaaggtcacttcaccagtggattgcagggtggt
gttaagattgtatattcccctgatgaggtaaaggaagttgcaagccaaatgcttggcaac
aaattaatcacaaaacaaactggtcagaagggcaggatatgcaacaaagttcttgtggtt
gagcgaaagtatgtaagacgggaattctactttgcaattactatggaacgtggaacgaaa
caatttggccctgtgttgattggtagtgcacagggaggcatggatattgaagctgtagct
tctaaaacacctgaagcaattttaaaagaatatgtcgatattaataatggctgtactgaa
gaacaagctgtaaaccttgccaagcgaatgggtttcaccgacagcaactgccaccaagct
gctgattgcattctaaaaatgtacaagctattcattgcgaaagatgcatctctgattgaa
attaatccgatggctgaagactctgatggcaatgtaatgtgcatggatgcgaagttaaac
tttgatgacaatgctgcacatcgacaaaaagagattttcaatttgagggattggagccag
gaagatgacagagacgctcaagcagcaaaagctgacattaattatatcggccttgatggt
aacatcggatgcttggtgaatggtgctgggctagccatggcaacgatggacattatcaaa
ctacatggaggaactccagctaacttcctggatgttggaggtggagcaactgcagatcaa
gtgatggaggcatttaaacttatcacatctgacgaaaatgtcaattcaatccttgtgaac
atatttggtggtattatgaggtgtgatgtgattgctcaaggcatcatacaagctgctcag
caacttgacctaaaaatccctatcattgtacgattacaaggtaccaaggttgaggatgca
aaagccctaatcgcgcaatcccaattaaaaattttgacatgcgacagtctcaatgaagct
gctaaaatggttgttaaactttctgacatagttggacttgcaaaagaagcttccattgac
gttaagtttgaacttcctatttag

DBGET integrated database retrieval system