KEGG   Ciona intestinalis (sea squirt): 100175992Help
Entry
100175992         CDS       T01056                                 

Definition
(RefSeq) uncharacterized protein LOC100175992
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00790  Folate biosynthesis
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100175992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100175992
Enzymes [BR:cin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     100175992
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100175992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 100175992
NCBI-ProteinID: XP_002120249
Ensembl: ENSCING00000024196
UniProt: A0A1W2W0K0
Position
2
AA seq 175 aa AA seqDB search
MLTGVDNVSVEYPVVVKMVVYFSLAGVFVQTGVSASRGIRHHNKTLEALSHCKQVCSGVL
LTSSYLSTSQVKHKRIKMSLTDAQRETELAPLKSAGWSMVKDRDAIYKEFLFSNFNESFG
FMTRVALKAETMNHHPEWFNVYNTVQITLSTHDVGGLSMRDVTLGKFIEEVFIKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttaactggcgtcgacaacgtctcggttgaatatcctgtcgttgtcaagatggttgtt
tatttttcactggctggtgtgtttgttcagacgggcgtttccgcttcacgaggcatacgc
catcataacaaaacgcttgaagcactatcgcactgtaagcaggtttgcagtggtgtctta
cttacctcttcgtacttgtcgacctcccaggttaaacacaaaaggattaaaatgagcctc
accgatgcacaaagggaaactgaattggctcctttaaaatctgctggatggtccatggtt
aaggatagagatgcaatttacaaggaatttttattttcaaattttaatgagtcttttggc
ttcatgactagggttgctttaaaagccgagaccatgaatcaccatccagaatggttcaac
gtatacaatacggtacaaatcacattaagtacacatgatgttggtggtctatcaatgcga
gatgttactttgggaaagttcattgaagaagtttttataaaaaaataa

DBGET integrated database retrieval system