KEGG   Ciona intestinalis (sea squirt): 100176137Help
Entry
100176137         CDS       T01056                                 

Definition
(RefSeq) N6-adenosine-methyltransferase subunit METTL3-like
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cin03019]
    100176137
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     100176137
Messenger RNA biogenesis [BR:cin03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     100176137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70
Motif
Other DBs
NCBI-GeneID: 100176137
NCBI-ProteinID: XP_009858262
Ensembl: ENSCING00000024805
UniProt: A0A1W3JBR4
Position
Unknown
AA seq 308 aa AA seqDB search
MGGSQVREFCPHATREECLKHNKLYIDCQKLHFRKILKSHTDETLGDCSFLNTCFHMDTC
KYVHYEIDYRGTDLDPRRKLKKEVSLPKFNEDYLSRKMLPPQWINCDIRYLDVSVLGKFS
VIMADPPWDIHMELPYGTMQDTEMRALRIQDLSDDGLMFLWVTGRAMELGRELFDCWGYK
RCDELIWVKTNQLQRLIRTGRTGHWINHGKEHCLVGIKGNPIGINRRLDCDVLVAEVRDT
SHKPDEIYGLIERLSPGTRKLELFGRVHNLQPNWVTLGNQLDGVHLAEYDVIDKFKKKYP
DGKVTKCE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggggggtcacaggttcgagagttttgtccgcacgcaacgagagaagaatgcttgaaa
cacaacaagttgtatattgattgtcagaaactacatttcaggaaaatacttaaatctcac
acagatgaaacgttgggcgattgttcgttccttaacacttgctttcacatggatacgtgc
aagtacgtccactatgagatagattaccgcggaaccgacctcgacccaaggcgaaagtta
aagaaagaagtttcacttccaaagtttaatgaggattatctttcgcggaaaatgttgcca
ccccagtggattaattgtgatataagataccttgatgtttctgtgttgggaaagttttcc
gtcataatggccgaccccccatgggatatacacatggagttaccctacggaaccatgcag
gatacggagatgagagctttaaggatccaagatttatcagatgatgggttaatgtttttg
tgggttaccgggagggccatggagttgggacgagaattgtttgattgttgggggtacaaa
agatgcgacgagttgatttgggtcaagacgaaccaacttcaacgtttgatacgaacgggg
agaacgggacactggatcaatcatgggaaggaacattgtttggtgggaattaaaggaaac
ccgatcgggataaatcgaagattagattgtgatgtattggtagcagaggttcgcgacaca
agccacaaaccagatgaaatttatggattgattgagagactatccccaggaacaagaaag
ttggagctattcggaagagttcataatttgcaacctaattgggtaacccttggcaaccag
ctcgacggagtgcatctagccgagtatgatgtcatagacaaatttaagaagaaatatcct
gatgggaaagttacaaaatgtgaataa

DBGET integrated database retrieval system