KEGG   Ciona intestinalis (yellow sea squirt): 100176380
Entry
100176380         CDS       T01056                                 
Symbol
ci-ndk/dm44
Name
(RefSeq) uncharacterized protein LOC100176380
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
cin  Ciona intestinalis (yellow sea squirt)
Pathway
cin00230  Purine metabolism
cin00240  Pyrimidine metabolism
cin00983  Drug metabolism - other enzymes
cin01100  Metabolic pathways
cin01232  Nucleotide metabolism
cin01240  Biosynthesis of cofactors
Module
cin_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
cin_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
cin_M00053  Pyrimidine deoxyribonucleotide biosynthesis, CDP => dCTP
cin_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100176380 (ci-ndk/dm44)
   00240 Pyrimidine metabolism
    100176380 (ci-ndk/dm44)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100176380 (ci-ndk/dm44)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cin04131]
    100176380 (ci-ndk/dm44)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     100176380 (ci-ndk/dm44)
Membrane trafficking [BR:cin04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100176380 (ci-ndk/dm44)
SSDB
Motif
Pfam: NDK DM10_dom Poxvirus_B22R_C ACT_4
Other DBs
NCBI-GeneID: 100176380
NCBI-ProteinID: NP_001155162
UniProt: C4B8X0
Position
1:complement(2459763..2461032)
AA seq 388 aa
MFPGYSDAYIEPSSAQDERYSFIAEWYDPQAALIRRYQFLYYPKDSSIEMFDIKNRRKFL
SRTKFESVRLEDLYIGSKVSIYSRQLTFVDFGDQFTESKLISKKEKTFALIKPDATSKLG
VILNGLRDRNIKVTKAQMVQMTRTDAVKFYDEHQSKPYFNSILEYITSGPVIAMEIVGSG
VVQKWLEMLGPSDPSEARTSNPKSIRAMFGTDELKNTAHGSINATAAAKELEFFFPSSGA
AFVGTAKYENSTCCVIKPHAVKEGLVGDIISVIMDAGFDITALSMQTVQKANAEEFYEIY
KGVVAEYKSMVDELCNGSCVVLEISGNDQDVPSKFRQLCGPSDPEIGRHLRPKTLRAMFG
KDAIQNAVHCTDLPEDGILEVEYFFRIL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtttcctggatacagcgacgcgtacattgaaccgtcatctgcccaagatgaaagatat
tcgttcatagctgagtggtatgacccgcaagcagctcttattcgacggtaccaatttctc
tactacccaaaagacagcagtattgagatgtttgacatcaaaaaccgtcgaaaatttctc
agccgaacaaaattcgaatctgtaaggcttgaagatctctatattggtagtaaagtgagt
atttattctcgacagttgacatttgttgattttggagaccagttcactgaaagcaagctt
atcagcaaaaaggaaaaaactttcgctttgattaagcccgatgctacctctaagttaggt
gtaatactaaacggtcttcgagacagaaacataaaggtcacaaaagctcaaatggttcaa
atgacaagaacagatgctgttaaattttacgatgaacaccaatcgaagccttactttaac
tccatactggaatacatcactagtggacctgttatagccatggaaattgtgggatctggt
gtggtacagaaatggttagagatgttaggaccatcagacccatctgaggcaagaacatcc
aacccaaaaagtataagagcaatgtttggcacagatgaattgaaaaacacagcacatggt
tcaatcaatgcaacagctgcagcaaaagaattagaatttttcttcccatcttccggtgct
gcctttgtcgggacagcaaagtatgagaattcaacatgctgtgttattaagccccatgct
gtaaaggaaggcttggtaggagacattatcagtgtaattatggatgctggatttgacata
actgctcttagcatgcaaactgtgcagaaagcaaacgctgaagagttttatgaaatctac
aaaggcgttgtggcggaatacaaaagcatggttgacgagctatgtaatggttcctgtgtg
gttctagaaatttctggcaatgaccaagatgtaccatcaaaatttagacagctgtgtggg
ccatcggacccagaaatcggcagacacttacgtccgaagaccctcagagcaatgttcggg
aaagatgccatccaaaatgcagttcattgcacagatctacctgaagacggcatactggaa
gtcgaatatttcttcagaatcctctaa

DBGET integrated database retrieval system