KEGG   Ciona intestinalis (sea squirt): 100177796Help
Entry
100177796         CDS       T01056                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:cin00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100177796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cin01001]
    100177796
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100177796
Protein kinases [BR:cin01001]
 Serine/threonine kinases: Other
  CAMKK family
   100177796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH LEDGF Kdo ATP-grasp_2
Motif
Other DBs
NCBI-GeneID: 100177796
NCBI-ProteinID: XP_002120749
Ensembl: ENSCING00000003945
UniProt: A0A1W2W7A4
Position
Unknown
AA seq 433 aa AA seqDB search
MTNNVEDQDMLLNKVIEKVGKVKLESRSDSGITLTVPDETAESDAEVKVQYELDSGTSSP
THRRSTKISPQHDVKTSRSRTTVTSNKITQENMKLNQYLLKNDLGRGAYGMVKLVYNEDD
NNLYAMKILSKRKLIKQAGFARRPLKGGKKRLTPLDRVYQEIALLKKLDHPNVVKLVEVL
DDPAEDNLYMVFELLNNGEILEVPTTEPLDEETAKRRFQDVVLGLEYLHYQKIIHRDIKP
SNLLLDDNNRVKIADFGVSQEFSGGDAEITNTVGTPAFMPPEAVSGSSDKFSGRPLDIWS
LGVTLYCLLVGDTPFKSPHILELHEQICNEEVKFPPQCSLSAEVRMLIKKMLDKNPQTRI
TLAEIKRNNWVTSHGSVVLPSEQQHCHLVTITEEDVEKCVKTIPKLNTLILVKSMLKRHS
FKNPLLASKSENT
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataatgtggaggaccaagacatgcttctaaataaagttattgaaaaagttgga
aaagtgaaattggaatccagaagtgattctggcattactcttactgttccagatgaaact
gcggaaagcgatgctgaagttaaagtgcaatatgaactcgacagcggcacgtcaagtcct
acgcaccgacgatcaaccaagatatcaccgcaacatgatgtgaaaacaagcagatctcgc
acgacagttacatccaataaaatcactcaggaaaacatgaaattgaatcaatacttgttg
aagaatgatttgggtcgaggtgcttacgggatggtgaagttggtttacaatgaagatgat
aataatctttatgcaatgaaaatactctccaagaggaaactgataaaacaagctggattt
gcaaggagaccccttaaaggaggaaagaaaaggttgactccacttgacagagtgtatcaa
gagatagctctgctgaagaaactagatcaccctaatgttgttaagcttgttgaggtatta
gatgatccagcagaagataatctatacatggtgtttgaactcctaaataatggtgaaata
ttagaagttccaaccactgagcctctggatgaagaaactgccaaacgaagattccaagat
gttgttcttggtcttgaatatcttcattaccagaagataattcaccgtgacattaaacct
tcaaatctacttcttgacgataataacagagtcaaaattgcagattttggagtaagtcag
gagtttagtggtggggatgctgaaataacaaacacggtcggtactcctgcgtttatgcca
ccggaggcagtgtcaggctcttcggataaattctcaggtcgcccccttgatatttggtca
cttggtgtcactctttactgcctactagtgggagacactccgttcaaatcaccccatatt
cttgaacttcacgaacaaatttgcaacgaagaagtgaagtttccgcctcaatgttcgtta
tctgctgaagttcgcatgttgatcaaaaaaatgctcgacaaaaatccccaaaccagaata
actctcgctgaaattaagcgtaacaattgggtgaccagtcatgggtcagtggttttgcca
tcggagcaacaacactgccaccttgtgacgataacagaggaagacgtcgagaaatgcgta
aaaactattcccaagcttaatacgctgatacttgtcaagtcgatgctgaaacgacacagc
ttcaagaatcctttgttggcttcaaagtctgaaaatacctga

DBGET integrated database retrieval system