KEGG   Ciona intestinalis (sea squirt): 100179675Help
Entry
100179675         CDS       T01056                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100179675
Enzymes [BR:cin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     100179675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP DUF99
Motif
Other DBs
NCBI-GeneID: 100179675
NCBI-ProteinID: XP_002125692
Ensembl: ENSCING00000004958
UniProt: F6X9L5
Position
3
AA seq 474 aa AA seqDB search
MRFVSTRGKTVDITFEEALFTAYTEDGGLLMPETIPNISLATLQRWKGLSYVELVKEIIP
LFVSTTEISLKEQQELIDAALSSFDIPDALRIERLTNDLNVLEMWHGKTLAFKDLAMSCT
TQFVNYFLKKRDRHFTAVVVTSGDTGSSAMQNSIGLDNLDIIVMFAYQKIAKLQELMMTT
IQADNMHVYAVDAASSDDADELVEKIFTDHKFVTEHSVGTLNSQNWCRIMVQIVHHVYAY
LQTANEVGEPVDIIIPVGGFGNTTSCLIAKKMGIPLGIVCVSNKNDFLNQVLKTGVIDQA
PSHLTLAPAMDIAFPINFERILWLLSGSDGKIVSKIMKEFRTSGSTTLPTDLMEKVKSTL
RSASAGDDVIINTIQRCWKENEYHICPHTATAVACFYGLTEGYKHSGNSAICLATASAAK
FSEAVIKAGLPLKRSPRIDDLNENDARYERLRKGDDWQEILRKKICSITAQSKR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagattcgtaagtacaaggggaaaaaccgttgacataaccttcgaggaagcgttattt
actgcttataccgaagatggcggattgttgatgccagaaacaataccaaatatatctctt
gcaaccctacaacgttggaaagggttaagttatgtggaattggtgaaagaaattattcct
ttgtttgtgtcaacaactgaaatatctttaaaagaacagcaagagttaatagatgcagct
ttgtcttcatttgatattcctgatgcgctgcgaatagaaagactgacaaatgatttaaat
gtattggagatgtggcatggaaaaactttagcattcaaggatttggcaatgtcctgcacc
acccagtttgtcaattattttttaaagaagcgagaccgacatttcacagcagttgttgtc
acttctggtgataccggcagcagtgcaatgcagaattctattgggttggataacttggat
attattgtaatgttcgcatatcaaaagattgcgaaactacaggaactcatgatgacaaca
attcaagctgataacatgcatgtttatgcagttgatgcagccagttcagatgatgctgat
gaacttgtggaaaagattttcacggatcataagtttgtcactgagcattctgttggaaca
cttaactcccagaactggtgtcgtattatggtacagatagttcaccatgtttatgcttat
ctacaaactgctaatgaagttggtgaacctgtggacatcatcatcccggttggtggattt
ggaaacactacatcttgcttgattgctaaaaaaatgggaattcctttggggattgtctgc
gtttcaaacaagaatgattttttaaatcaagttctaaaaacgggtgtaattgatcaggct
ccttcccatcttacactcgcgccagccatggatatcgcattcccaatcaattttgagcga
attctttggttgttgtctggaagtgacggaaaaattgtttcaaagataatgaaagagttc
aggacttcaggttctacaacgctgccaactgatttgatggaaaaggtgaaatccaccctc
cgatccgcatcagcaggtgatgatgtaattattaatacaatacaacgctgttggaaggaa
aacgaatatcacatctgcccacatacagctactgctgttgcttgtttctatggattgaca
gaaggatacaaacattccggaaattcagccatctgtcttgctacagcatcagctgctaaa
ttcagtgaagctgtcataaaagctgggttgcctctgaaaagatcaccaaggattgatgat
ctgaatgaaaatgacgccagatacgaaaggttaaggaaaggcgatgattggcaagaaatt
ctacgcaaaaagatttgttcaataacagctcaatcaaaacgctaa

DBGET integrated database retrieval system