KEGG   Ciona intestinalis (sea squirt): 100180075Help
Entry
100180075         CDS       T01056                                 

Definition
(RefSeq) DNA polymerase delta subunit 4-like
  KO
K03505  DNA polymerase delta subunit 4
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00230  Purine metabolism
cin00240  Pyrimidine metabolism
cin01100  Metabolic pathways
cin03030  DNA replication
cin03410  Base excision repair
cin03420  Nucleotide excision repair
cin03430  Mismatch repair
cin03440  Homologous recombination
Module
cin_M00262  DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100180075
   00240 Pyrimidine metabolism
    100180075
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100180075
   03410 Base excision repair
    100180075
   03420 Nucleotide excision repair
    100180075
   03430 Mismatch repair
    100180075
   03440 Homologous recombination
    100180075
DNA replication proteins [BR:cin03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100180075
DNA repair and recombination proteins [BR:cin03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100180075
   MMR (mismatch exicision repair)
    DNA polymerase delta complex
     100180075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_delta_4
Motif
Other DBs
NCBI-GeneID: 100180075
NCBI-ProteinID: XP_002126525
Ensembl: ENSCING00000018340
UniProt: H2XMK0
Position
Un
AA seq 107 aa AA seqDB search
MNEQKVTNYLRKKKNLPKLKDQPCDLPSNVGTPDCLSPSVDEQLKQLRDFDLNNKFGPSQ
GIPRVDRWERASRLQLDPPIHIMQILQSNLNNNKFQSSIWSGHKLLD
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaaaaagtcacaaattatttaagaaaaaagaaaaatttgccaaaactgaaa
gaccaaccgtgtgacctcccatccaatgttggaaccccagattgcctttcacccagcgtg
gatgaacaattgaagcaattacgagattttgatttaaacaataagttcggaccaagtcaa
ggaatacctcgtgttgatcgttgggaaagagcttctcgattacagcttgaccccccaata
catatcatgcagatattacaaagcaacttaaacaacaacaagtttcaatcttccatatgg
agtggtcacaaacttttagactga

DBGET integrated database retrieval system