KEGG   Ciona intestinalis (sea squirt): 100180076Help
Entry
100180076         CDS       T01056                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cin04147]
    100180076
   04031 GTP-binding proteins [BR:cin04031]
    100180076
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100180076
  Exosomal proteins of colorectal cancer cells
   100180076
GTP-binding proteins [BR:cin04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100180076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf
Motif
Other DBs
NCBI-GeneID: 100180076
NCBI-ProteinID: XP_004227219
Ensembl: ENSCING00000003111
UniProt: A0A1W2WLE8
Position
Unknown
AA seq 366 aa AA seqDB search
MGQKCNKMSLDCTGSCFFNDTNKTKSNAIDRDIAKEKMFYKRQVKLLLLGCGESGKXTFL
KQMRILHGQGYDDKALLEFRATVYSNIVKGMKVLVDARNKLGIPWEDPSRQSQADYIMTF
ERYVSTDVDPFLQYVPHIKELWKDEGIHTAYYRRREFQLGESVHYFLENLDRIGQSDYVP
SMQDVLLSRQATRGIQEYVFEIRRIPFRFFDVGGQRGQRQKWLKCFEDVTSILFLASSSE
FDQVLMEDRKTNRLQESLDIFELIVNNRYFVNVSIILFLNKSDLLEEKVKQGVLLSDYFP
DFEGDPLDLSDVQNYLVYKFESQRRDRGKPFFHHFTMAIDTNNIRFVFNAVKDTILHDNL
HQLMLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaagtgcaacaagatgagtttggattgtacaggtagttgcttcttcaatgat
accaacaaaacaaagagcaatgctatcgatcgagatatagcgaaagaaaaaatgttttac
aaacgacaggtcaaactattattacttgggtgtggtgagagtggcaaangtactttcctc
aagcagatgaggatattacacgggcaaggttatgatgataaagctttgcttgagtttcga
gcaactgtgtatagcaacattgtaaagggaatgaaggtccttgtggatgccaggaacaaa
cttgggattccatgggaagacccaagcaggcagagccaagcagattacattatgacgttc
gagcgatatgtctcaaccgacgttgatcccttcctacagtacgtcccccatatcaaggag
ttatggaaagatgagggaatccacacagcttattacagaaggagggaatttcaattaggg
gaatctgttcattattttctagaaaatttagatcgaataggacaatcggactatgtacca
agcatgcaggatgttttactatcacgacaagcaacacggggcatccaggaatatgtgttc
gaaatccgacgaataccttttcgatttttcgacgtggggggccagcgtggccaaagacag
aaatggctgaaatgttttgaagacgtcacttccattttgttcctcgcatcttcctccgag
ttcgatcaagttttgatggaagatcggaaaaccaatcgactccaggagtcgctcgacatc
ttcgagttgatcgtcaacaaccgatacttcgtgaacgtttcaatcatcctcttcctcaac
aagtccgatctactcgaggagaaagtgaaacaaggagtcttactttccgactatttcccc
gattttgaaggagatccattagacttatcagatgtacagaactatttagtgtacaagttc
gaatcccagcgaagggacagaggaaaacctttcttccatcacttcacgatggctatagac
actaacaacatccgattcgtgtttaacgcggtaaaagacacgatcctacacgataacttg
caccaacttatgctgcagtga

DBGET integrated database retrieval system