KEGG   Ciona intestinalis (sea squirt): 100180260Help
Entry
100180260         CDS       T01056                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00020  Citrate cycle (TCA cycle)
cin00640  Propanoate metabolism
cin01100  Metabolic pathways
cin01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100180260
   00640 Propanoate metabolism
    100180260
Enzymes [BR:cin01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100180260
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100180260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 100180260
NCBI-ProteinID: XP_002123295
Ensembl: ENSCING00000005457
UniProt: A0A1W2WAL6
Position
10
AA seq 331 aa AA seqDB search
MLATSLTRQVFAHSRQFVRGLGYEATRKNMKINSQTKVICQGFTGKQGTFHSKQAIAYGT
NMVGGVSPKKAGTNHLGLPVFKDVAEAREATGAEASVIYVPPPFAAAAIMEAIDAEIPLV
VCITEGIPQQDMVKVKRRLQQQDKTRLIGPNCPGIILPGECKIGIMPGHIHMPGNIGIVS
RSGTLTYEAVHQTTNVGLGQTLCVGIGGDPFNGTNFVDCLEVFLNDPQTEGILLIGEIGG
GAEEKAAAYLAEHNTGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAEGKIESLRD
AGVNVTLSPAEMGITMIKEYTKFYGGRKTSA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttagccaccagtctgacgcgccaagtttttgcccatagcaggcaattcgtacgaggt
cttggctatgaagcaacgcgaaaaaatatgaaaataaactcccagacaaaagttatttgt
caaggcttcactggtaagcaaggtaccttccacagcaagcaagcaatcgcgtatgggacc
aacatggttggcggtgtctctcctaagaaagccggaaccaaccatctggggttgcctgtg
tttaaagatgtagctgaagctcgtgaggctacaggtgctgaagcttcggttatctatgtg
ccgcctccatttgctgcagctgctatcatggaagcaattgatgctgaaataccgttggtc
gtgtgcataactgagggaattcctcaacaagatatggtgaaagtgaagcgcagattgcaa
cagcaagataaaacgagattgatcgggcccaattgtcctggtattattcttcctggcgaa
tgcaaaatcggaatcatgccaggacacattcacatgccaggcaatattggcattgtctcc
agatctggcacgcttacatatgaagcagttcaccaaaccaccaatgttggacttggccaa
actctctgtgttggaattggaggcgatccattcaacgggactaactttgttgattgtttg
gaagtctttcttaatgatcctcagaccgaaggaatcctcctcatcggagaaattggagga
ggagccgaagaaaaagcagctgcgtatcttgccgagcacaacactggagcaaatgcgaag
ccggtggtttccttcattgctggtcttactgcaccacctggcaggcgcatggggcatgct
ggagccatcattgctggaggcaagggaggagcagaggggaagattgaatctcttcgggat
gcgggagtgaacgtcaccctttctcctgctgagatgggaatcacgatgatcaaagaatac
accaagttttatggtggtagaaagaccagtgcatag

DBGET integrated database retrieval system