KEGG   Ciona intestinalis (sea squirt): 100180391Help
Entry
100180391         CDS       T01056                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 1
  KO
K12733  peptidyl-prolyl cis-trans isomerase-like 1 [EC:5.2.1.8]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100180391
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cin03041]
    100180391
   03110 Chaperones and folding catalysts [BR:cin03110]
    100180391
Enzymes [BR:cin01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100180391
Spliceosome [BR:cin03041]
 Complex B
  Other components
   Prp19-related factors
    100180391
 Complex C
    100180391
Chaperones and folding catalysts [BR:cin03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    100180391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 100180391
NCBI-ProteinID: XP_002127845
Ensembl: ENSCING00000004845
UniProt: A0A1W2WHN3
Position
8
AA seq 175 aa AA seqDB search
MSGIPPSTWRPSHVIFETSAGTIEIELYWNHAPKTCANFAELCRRGYYNKTIFHRIITNF
MIQGGDPTGTGRGGSSIYGGQFEDEFSRELKHTGAGVLSMANSGPNTNGSQFFITLAPTQ
WLDMKHTIFGRVSGGIKVVNLLGMVETSAQDRPVQDVVVRNAYAADEGGNRIDTY
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaatacctccctcaacatggcgaccttcacatgttatttttgaaacgtcagca
gggacgattgagatagaactgtactggaatcatgcacccaaaacatgtgcaaattttgct
gagctgtgtaggagaggctactacaataaaacaatttttcatcgtattattacaaacttt
atgatacaaggaggtgacccaactggaactggtcgtggaggctcctcaatttatggcgga
cagtttgaagatgaatttagtcgcgaactaaaacacacaggtgctggtgtgctttcaatg
gcaaattctggccctaacaccaatggcagccagttttttatcacccttgctcctacccag
tggttagatatgaagcatactatatttggaagggtgagcgggggtataaaggtggtaaat
cttttgggaatggtggaaacaagtgcccaagaccgtcctgtgcaagatgtggtggtgcgc
aatgcttatgcagcagatgagggtggtaacaggattgacacttactaa

DBGET integrated database retrieval system