KEGG   Ciona intestinalis (sea squirt): 100180504Help
Entry
100180504         CDS       T01056                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial-like
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00970  Aminoacyl-tRNA biosynthesis
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100180504
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cin03029]
    100180504
Enzymes [BR:cin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     100180504
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     100180504
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100180504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2496
Motif
Other DBs
NCBI-GeneID: 100180504
NCBI-ProteinID: XP_002127266
UniProt: A0A1W2WGJ7
Position
14
AA seq 538 aa AA seqDB search
MMVNLIWNILCTRCMRVIANQKRHYVSEAKNIRVLHEQKWLPVIGLEVHAQINSRTKLFS
SALNKFMAPPNSLVSEFDASMPGTLPVLNKECVRAAVLTSLALNCKINPRSTFDRKHYFY
ADMPHGYQITQHWNPIAVDGKVTFPTLQGQKSLRIERVQLEQDSGKSLHDYEDNVSLIDL
NRAGVGLMEIVTFGLSNADDACAFVNELHLMLVTLGTCEGKMSEGQLRVDVNISLHKPGE
PLGTRAEVKNINGMRILHQVIEHEILRQSDLLDHGFAVEQETRGYDDVNRTTYSMRDKEM
KTDYRFMPEPNLPPLQLYDDLTIHNTCGDGINIDDIRREIPLLPAQLRKILDEKYKLDEQ
EIKFLLDREMVNYFIQVSELLPNTPPIEVYHWLKIKVVALLADNGLMMSQWPFNAKDFAD
LMSLKENNEINDSIAFEALTVAVKDKATTPVQVIENMGWKMISDITMISSLCDDVIIAME
TENPEVFEKYNVNNAKSNKKIVAKVVGKVFKASQGKMHTAIIKKTVQDLLNEKYNTNV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcaacttaatatggaacatactttgcacaagatgtatgagggtgattgcaaat
cagaaacgtcactatgtgagtgaagccaagaatataagggttctgcacgaacaaaaatgg
cttccagtaattgggttggaggttcacgctcaaattaactccagaaccaagctgttttca
tcagcgttgaacaaattcatggctcctcctaattcactggtgtctgaatttgacgcctca
atgcctggaacattacctgttctaaacaaggaatgtgttcgagcagcagtgttgacctct
cttgctctcaactgtaaaattaatccaagatctacttttgatcggaaacactatttctac
gcagatatgccgcatggctaccagattactcagcattggaatccaatagcagttgatggt
aaagtaactttccccacactacaaggccagaaatcactgcgtattgaacgagtgcaactt
gaacaagacagtgggaaaagtctccatgattatgaagataatgtttcacttatcgacttg
aacagagcaggagttggcttaatggagatagttacgttcgggttaagcaacgctgatgac
gcttgtgcttttgtgaatgaactccatcttatgctggttacactgggcacatgtgaaggc
aagatgtctgagggccagttacgcgttgatgtcaacatttcacttcataaacctggggaa
cctttgggtacaagggctgaggtaaagaatataaatggaatgaggattcttcatcaagtt
atagagcacgaaatattgagacaaagtgatttattggatcatggctttgctgtggaacaa
gagacaagaggatatgatgacgttaacagaaccacatattcaatgcgtgataaagaaatg
aaaacggattatcgtttcatgccggaacctaacctgcctcctttacaattgtatgatgac
cttaccatacataacacatgtggtgatggtataaatattgatgacatcagaagggaaatc
ccccttctccctgcacaactaagaaaaatactggatgaaaaatataaattggatgaacaa
gaaatcaaatttttgttggatcgtgagatggtgaattattttatccaagtctcagagctt
cttccaaacaccccaccaatcgaggtttaccattggttgaaaattaaagtggttgcattg
ttagctgacaatgggttgatgatgtcacaatggcccttcaatgctaaagactttgcggat
cttatgtctctcaaagaaaataacgaaataaacgatagcattgcatttgaagcactaact
gtggctgttaaagacaaggccactacaccagttcaggtgattgaaaatatgggttggaag
atgatttctgacatcactatgatatcatcattatgtgatgatgtcatcattgccatggaa
acagaaaacccggaagtgtttgagaaatacaatgtaaacaatgcaaagtcaaataagaag
attgtagcaaaagttgtaggtaaagtgttcaaagccagccaaggtaagatgcacaccgcg
attataaagaaaactgttcaggatttgttgaatgaaaaatacaatacaaatgtgtaa

DBGET integrated database retrieval system