KEGG   Ciona intestinalis (sea squirt): 100181881Help
Entry
100181881         CDS       T01056                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC3 isoform X1
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cin04131]
    100181881
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100181881
Membrane trafficking [BR:cin04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    100181881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF4052 Peptidase_C5
Motif
Other DBs
NCBI-GeneID: 100181881
NCBI-ProteinID: XP_002126411
Ensembl: ENSCING00000019053
UniProt: H2Y0K9
Position
Unknown
AA seq 279 aa AA seqDB search
MVFHKDPCGVFCILFTYALVAYADYVIIQHVILTTLTGSIWGAVHCVLFNTIIFGVLYSH
ARTVFSDPGIVPLPIMGLDFSDLHVQGKGHMDQSNGEDWTVCQRCETYRPPRAHHCKICR
RCVRRMDHHCPWVNNCIGEMNQKYFIQFLFYTALLCIYALILNISGWMWMFGNARSSNAD
LLSRKSTVAHGIGLCIESILFGLFVIVMLFDQISSIFGDETGVEYTIHRSRKTRPPRPRK
PRMALLREVFGYGPVYTWLMPCSAPGGTVRSLVPGSYDV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggttttccataaagatccttgtggggtattctgtattttgtttacctatgcgttggtg
gcatatgcggactatgttatcattcaacatgtaattcttactacattgacgggaagtatt
tggggagctgttcattgcgtgttgtttaacacaattatattcggagtgctttattcacat
gcaagaacggtcttttcggatccaggaatagttccgttgcccattatgggacttgacttc
tctgatctacatgtacaaggcaaaggtcacatggaccagagcaatggagaagattggaca
gtttgtcaacgatgtgaaacctacagaccaccgagagctcaccattgtaaaatatgcagg
cgttgtgtgagacgtatggatcatcattgtccatgggtgaacaactgtatcggtgaaatg
aatcaaaagtattttatccaattccttttttatactgcattgctgtgtatttatgcatta
atactcaatatatctggttggatgtggatgtttggaaatgctagaagttctaatgctgat
ctactttcaagaaaatctactgtagcacatggaatcggcttatgtatagaatccatttta
tttggtttgtttgtgattgttatgttgtttgaccagatatcttcaatatttggggacgaa
actggagtggaatatacaatacatcgcagtcggaaaactagaccccctcgacccagaaag
ccaagaatggcattattacgagaagtatttggttacggaccagtttatacctggctgatg
ccatgttctgcacctggtggtacggtgcgatctcttgtcccaggaagttacgacgtttga

DBGET integrated database retrieval system