KEGG   Ciona intestinalis (sea squirt): 100182429Help
Entry
100182429         CDS       T01056                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7-like
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cin  Ciona intestinalis (sea squirt)
Brite
KEGG Orthology (KO) [BR:cin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cin01009]
    100182429
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100182429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 100182429
NCBI-ProteinID: XP_002125791
UniProt: A0A1W2WC56
Position
1
AA seq 331 aa AA seqDB search
MSLKEENDNVEDALSDDDKPSFPTKTNEIVDESFNLEKMLDPDAECVDLEHCRIGSIAGF
ERLKKVEELCLRNNLLKQIQGLGCLASTLTSLDLYDNRIKKIENLEDLVLLESLDLSFNL
MRTIEGLENLVKLKKIYLLTNKFTKIQNLSHLTSLTMLELGDNRIRAIEGLETLKNLQEL
YLGKNKITTIGNLSELKNLKILALMSNRITKIEGLDALTNLEELYMSHNAIEKIEGLENN
TNLQTLDVAGNKITRVENLSHLSELEEFWANDNKIHDWNDMDELKKCPKLITVYLEHNPL
QTSHATQYRRRLMAIMPNLKQIDATYTRSAM
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaaaagaagaaaacgacaatgttgaagatgcactatcagatgatgacaagcca
tcatttcctacaaaaacaaatgaaatcgtggatgaaagttttaacctggagaaaatgctt
gatccagatgcagagtgtgttgatttggaacattgtcgcattggaagtattgctggtttt
gaacgactaaaaaaagtggaagaattatgtttacgaaataatctactaaaacaaatccaa
ggtcttggttgtctcgcttcaactcttacgtctcttgacctttatgataacaggatcaag
aaaattgagaatttggaagatctcgtcttgctagaatctctggatttgtcattcaacctt
atgcgaactatcgaaggattagaaaaccttgtcaaattaaagaaaatttatttgctgaca
aataaattcacgaaaattcaaaaccttagtcacttaacaagtctgactatgctggagctt
ggtgataaccgtattagggcgattgaagggttagaaacgctcaaaaatcttcaagaatta
tatcttgggaaaaacaaaatcacaactatagggaacctcagtgagctgaaaaacctgaaa
atcttagctctcatgagcaacagaataacaaagattgaaggtcttgatgcactcactaat
ctggaagagctttatatgagccacaacgcaattgaaaaaattgaaggcttggaaaataat
actaatcttcagacattagatgttgctggaaacaaaataactcgagtagagaatctttct
catttgtcagaactggaagagttttgggcaaacgacaacaaaatccatgattggaacgat
atggacgaactaaagaaatgtcccaagttaattaccgtctacttggaacacaatcctcta
cagacttcccatgccacgcaataccgcagaaggttaatggccattatgccaaatttgaag
caaattgatgccacgtacacacggagcgctatgtga

DBGET integrated database retrieval system