KEGG   Ciona intestinalis (sea squirt): 100182991Help
Entry
100182991         CDS       T01056                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00450  Selenocompound metabolism
cin00970  Aminoacyl-tRNA biosynthesis
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100182991
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100182991
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cin01007]
    100182991
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cin03016]
    100182991
Enzymes [BR:cin01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100182991
Amino acid related enzymes [BR:cin01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100182991
Transfer RNA biogenesis [BR:cin03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100182991
 Prokaryotic type
   Other AARSs
    100182991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 100182991
NCBI-ProteinID: XP_002128793
UniProt: A0A1W2WCY6
Position
11
AA seq 883 aa AA seqDB search
MMEINGQPSPEKLKVLLACFETGLHKIKVNSKPGSALSVRLDNEIEFTSSNAAVRYTYET
QGVKVDVETLHWFEWEVTILRKLVGSYFSLSDKKILNINEFPNLISSLQYLENSINSGKL
ECDFSTKISAANCVIFCTISPLFCNPGIEGEFPVLRKHFAIFMNRGSFRSAWKEVTGGEG
RLAFQAYFAATKAQWKETKPIISTETSKPTEPNNSSKEVVSEDEIEAARKSWDSCNVQTA
KPRVHPVLPKEGEKNILITSALPYVNNVPHLGNIIGCVLSADVFSRYCRLRGWNVLYICG
TDEYGTATETKAAQEGVTPKEICDKYHKIHSEVYEWFSIGFDYFGRTTTECQTKIAQDIF
WHLHRNNHLIKQTVEQLYCGRCERFLADRFVEGTCPLCAFEDARGDQCDKCGKLINAVEL
KSPKCKMCSDTPAIRTSEHLFVDLSKLEPKLRRCLQESFKGEGWSNNAKTITETWLRDGL
KPRCITRDLKWGTPVPLEGFTDKVFYVWFDAPIGYLSITANYTDKWELWWKNPKNVQLYN
FMAKDNVPFHSVVFPSCLLGTDDEYTIVNHLNATEYLNYEEGKFSKSRGVGVFGDHASKT
NIDSDIWRFYLLSMRPEGQDTHFSWSDFLLKNNSELLNNLGNFINRSLKFVSNAYGGVVP
DPVLNNTDLELLALVNRELKDYVTDMDKLKIRDNLRRILSISRLGNQYLQENQPWKLIKG
SNDDKSRASTVTSIAANLSCLLCILIHPYMPQTSSIIQDQLNLRGGYLIPDAITRMLPSG
HKINKPSPLFRKLEEAEIEEYKAKYRGREDGKKEVAKVEVGDCKGLEEEVLKQGNLVREL
KTAKAEKLEIEREVSKLLELKKKLSLLKGEEPVQKKKGKKKKK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaataaacggacaaccaagtcctgaaaagctgaaggtattgctggcttgcttt
gaaactggacttcataaaattaaagtcaactctaaaccaggttctgcattatcagtgaga
cttgataatgagattgaattcacctcatccaatgctgctgttagatacacttatgaaaca
caaggtgttaaagtagacgttgaaacattgcattggtttgaatgggaggtcacaatacta
aggaaacttgtgggaagttacttcagtttatccgacaagaagattttgaacatcaatgaa
ttcccaaacctcatttcttcgttgcaatatttagaaaattcaatcaactcaggaaagctg
gagtgtgacttcagtactaaaatctcggctgctaactgtgtcatcttctgtaccatctcg
cccctcttttgcaaccctggtatagaaggggaattccctgtcctgagaaaacattttgct
atctttatgaatcgaggatcgtttagatcggcgtggaaggaagttaccgggggtgagggg
aggctcgcgttccaggcgtattttgctgccactaaagcccagtggaaagaaaccaaacca
atcatttcaactgaaacgtcaaaaccaactgaaccaaacaattcttcaaaggaagttgta
agcgaagatgaaattgaagctgcaaggaaaagttgggactcgtgtaatgtgcagacagcc
aagccaagagtgcaccccgtacttccaaaggaaggcgagaaaaacatcttaatcacgagc
gctctaccctacgttaacaacgtccctcacctgggcaacattatcgggtgtgtgttgagt
gccgatgtcttttcaagatattgtcgcttacggggttggaacgtcctttatatttgcggc
acagatgaatatggcacggcaactgaaactaaagctgcacaagagggagtgacgcccaag
gagatatgcgacaagtaccataagatccactccgaggtttacgaatggtttagtatcggc
ttcgattactttggcaggacaactactgagtgtcaaacaaaaattgcgcaagatatattc
tggcacctgcatcgcaacaatcaccttattaaacaaacggttgaacaactctactgtggg
cggtgtgaaaggtttctggctgacaggtttgtggagggcacgtgtccattatgtgcgttt
gaagatgcacgaggggaccaatgtgataaatgtggaaagttgattaatgctgtggaatta
aagagtcctaaatgcaagatgtgtagcgacacaccagccataaggacgtcggaacatttg
ttcgtggatctttcgaagttggagccaaagttacgaaggtgtttacaagaatcattcaaa
ggggaggggtggtccaataatgcaaagacgataactgaaacatggttaagagatggcctc
aaaccaaggtgtataactagggatctaaaatgggggacgccggtcccactggaagggttt
actgataaagtattttacgtttggtttgacgcccctattggttacttatccatcacagcc
aactataccgataaatgggagttatggtggaagaaccccaagaatgtacagttgtacaac
ttcatggcgaaggacaacgttcccttccacagcgttgtgttcccatcttgtttacttggt
actgatgatgaatatacaattgtgaaccatcttaatgctacagaatatttaaattatgaa
gaaggaaagttttccaagagtcgtggagttggtgtgtttggtgatcacgcttccaagacc
aatatagattctgacatctggaggttctacctcttatccatgagacctgaaggacaagac
acccacttcagctggagtgatttcttactcaagaataattctgaactcctgaacaatctt
ggcaactttatcaatagatcattgaagttcgtatcgaacgcatacggaggtgtcgttcct
gatccagttctcaacaataccgaccttgaactactagcattggttaacagggagcttaaa
gattatgttacggacatggataaactaaagatccgtgacaacctgcgtaggatcctgagc
atatcaaggttggggaatcaatatctacaggagaaccaaccttggaagttaattaaggga
agcaatgatgataaatctcgtgcctccaccgtcacctccatagcagcgaacctctcctgc
ctcctctgcatcctcatccacccgtatatgccacaaacatcttctatcatacaggatcaa
ctcaacctccgaggaggatatttgatcccggatgcgatcacaaggatgttgccatccgga
cataagatcaacaagccctcccctttgttccgtaagttggaagaagccgagatcgaggaa
tacaaagctaagtatcgaggtagagaggatgggaagaaggaggtcgctaaggtggaggtt
ggggattgtaaaggtttggaggaagaagtgctgaaacagggtaacttggttcgggaactt
aaaactgccaaagctgagaaacttgaaatagagagagaagtctcaaagttgttggaatta
aagaagaagttatctctcttaaaaggagaggaacctgtgcaaaagaaaaaggggaaaaag
aagaagaaataa

DBGET integrated database retrieval system