KEGG   Ciona intestinalis (sea squirt): 100184046Help
Entry
100184046         CDS       T01056                                 

Definition
(RefSeq) cytosolic 5'-nucleotidase 3-like
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00230  Purine metabolism
cin00240  Pyrimidine metabolism
cin00760  Nicotinate and nicotinamide metabolism
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100184046
   00240 Pyrimidine metabolism
    100184046
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    100184046
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     100184046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD Adeno_knob
Motif
Other DBs
NCBI-GeneID: 100184046
NCBI-ProteinID: XP_002131716
Ensembl: ENSCING00000009520
UniProt: A0A1W2WJ00
Position
3
AA seq 299 aa AA seqDB search
MEVIKKMREEKGGKIFIKDEDVVSKKIQNLIDGGVDSFQVISDFDRTLSRASYNGEKCTT
CHGILESSIVFNEETQKDLAALKKRFYAIEIDPTMTIEEKCPYMVEWWETAHKIMIKSKV
KRTSIQQAVTESNVILKDNCKEMFQILNQNSVPLLIFSAGIADVLMEVLYQKSSFLPNIK
VVSNFMKFDENGVLVGFEGELIHVYNKNEGALTDSAYWYFEDIKHRHNICLLGDSMGDLH
MADGVPDVNTCLKIGYLNEKVEHLLPRYIDAWDIVLVDDPTMDVANVLFAAITDAIIKA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaagttatcaaaaaaatgagagaagagaagggtgggaagatttttatcaaggatgaa
gatgttgtttcaaagaaaatccagaatctgattgatggaggagtggattcttttcaagtt
attagtgactttgatcggactttgagcagagcaagttataatggtgaaaagtgtactaca
tgtcatgggattttagaatcttctatcgtgtttaatgaagagacgcaaaaagacttggca
gcgttaaagaaacgattctatgcgattgaaattgaccctacgatgacaattgaggaaaaa
tgtccatacatggtggaatggtgggaaactgcccataaaataatgatcaaatcgaaagtt
aagcgcactagcatacaacaagctgtgacagaatctaatgtcatacttaaagacaactgt
aaggagatgtttcaaattttaaatcagaattctgttcctctgctaatcttttctgcaggg
attgctgatgtactgatggaggtgttgtatcagaaatcatcttttctgccaaacataaaa
gtcgtctcaaacttcatgaagttcgatgagaacggagtgttggtgggttttgaaggcgag
cttatccatgtctataacaagaatgagggagcactgactgactctgcttattggtacttt
gaggatattaagcatagacacaacatttgtcttctcggcgactcaatgggtgacttacat
atggctgatggggtgcctgatgtcaatacttgtttgaagatcggatatttgaatgagaaa
gttgagcatttgttaccacgctatattgatgcttgggacattgttcttgttgatgatcca
acaatggatgttgctaatgtattattcgctgctataactgatgccattattaaagcatga

DBGET integrated database retrieval system