KEGG   Ciona intestinalis (sea squirt): 100184470Help
Entry
100184470         CDS       T01056                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00230  Purine metabolism
cin00240  Pyrimidine metabolism
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100184470
   00240 Pyrimidine metabolism
    100184470
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100184470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 AAA_28 Thymidylate_kin ABC_tran
Motif
Other DBs
NCBI-GeneID: 100184470
NCBI-ProteinID: XP_002125268
Ensembl: ENSCING00000002812
UniProt: A0A1W2WBB3
Position
14
AA seq 312 aa AA seqDB search
MRFRAFLTRVKHSHRDYSFCTLSNCSKVRLKMDSVQTVRRGKKFAIEGNIATGKSTFLKL
LESQSPDWSVVAEPVARWTNVSQDGDEVELTTSQKSGGNLLQMFYDDIHRWSYTFQSYAL
LSRMRLQREPLPASFTNEQVKKHVQFFERSMQSDRYIFALNCYESGCMSETEWNIYQDWS
QYLVHSIGELKLDGIIYLRANPEVCYQRMLKRGRPEESGVTMEYLECLNEKHESWLYRKD
VKMDESLSDVPVLVIDCNEEFVTNPEKHQSMMSMVHKFVGNPSTSLDDSGVDSQCSSISM
DSDEMDNSDIEY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagatttcgcgccttcttaacgagagtgaagcattcgcacagggattattcattttgc
acgctaagcaattgctcaaaagtacgtttaaagatggattctgttcaaaccgtacgaagg
ggaaagaaatttgcgattgaagggaacatagcaacgggaaaatcaacatttctaaagctt
ctggaatctcaatcgccggattggagcgtggtggcagaacctgtggcccggtggacgaac
gtaagtcaggatggtgacgaagttgaactgacgacttctcaaaaaagcgggggtaacctt
ttacaaatgttttacgatgatattcaccgttggtcgtatacttttcagtcctatgccctt
ctaagtcgcatgcgcttacaacgtgagccattgcctgccagctttactaacgaacaagtt
aaaaaacatgttcaattctttgaacgttcaatgcaatcagacaggtatatttttgcattg
aattgctatgaaagtggctgcatgtctgaaactgagtggaatatatatcaagattggtct
caatacttggtacatagcattggggagcttaaattggatggtataatttatcttcgtgct
aaccccgaggtttgctaccaacgaatgctgaaacgtggtcggccagaagaatcgggggtc
acaatggagtatctggagtgcttgaatgaaaagcacgaatcctggctttatagaaaagat
gtaaaaatggatgaatctcttagtgatgttcctgtattggtgattgactgcaatgaagaa
tttgttaccaacccagaaaagcatcagagcatgatgtcaatggttcataagtttgtgggg
aatccatctacttcattggatgattctggtgtcgattcacaatgtagctcaatctcaatg
gatagtgatgagatggacaattcagacattgaatattga

DBGET integrated database retrieval system