KEGG   Ciona intestinalis (sea squirt): 100184861Help
Entry
100184861         CDS       T01056                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00061  Fatty acid biosynthesis
cin01100  Metabolic pathways
cin01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    100184861
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     100184861
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     100184861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase ADH_zinc_N 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 100184861
NCBI-ProteinID: XP_002129957
Ensembl: ENSCING00000001307
UniProt: F6WW36
Position
9
AA seq 253 aa AA seqDB search
MSQRLAGKVAIVTGAASGIGRAICQRYANEGASLMLVDRNQERLKKATETLNTGHGNKHC
ISEGNVSEFDFANKLVDQVKETYGKAGNVLVNCAGITRDSLLINMTEKQFDDVIQVNLKS
IFTMTKAFIGTLRHTGGMHPASIINISSIVGKTGNAGQANYAASKAGVIGFTKTVGMEMG
RYGVRCNAILPGFIQTPMTDAVPEEIMKKYLKMIPMKRMGTPEEIANVCLFLGCDESSYV
NCATLEVTGGFFA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagactggctggaaaagtcgcaatagttacaggtgccgcgagtggaattggt
cgggcaatctgccaaagatatgccaacgaaggtgcgagtcttatgttagttgaccgtaac
caagaaagacttaaaaaagcaactgaaacactaaacacaggacatggcaataagcactgc
atttctgaaggaaatgtttcagaatttgattttgcaaacaaactagttgaccaagtgaaa
gaaacatatggtaaagctgggaatgtgttagtgaattgtgccggaataaccagagatagt
ttgttgataaacatgactgaaaaacaatttgatgatgtcattcaagtaaacttgaagagc
atttttacgatgacaaaagcttttattggaacattaaggcatactggtggaatgcatcca
gcttctattatcaatatctcaagtattgttggcaagacagggaatgcaggccaggcgaat
tacgctgcatccaaagcaggtgttattggattcacaaagactgttggaatggaaatggga
aggtacggcgtgaggtgtaacgctatcctgcctggttttatacaaacaccaatgacagat
gctgtgccagaagagattatgaaaaagtatttaaagatgattccgatgaaaagaatggga
actcctgaagaaattgcgaatgtatgtttattccttgggtgtgatgaaagctcttatgtc
aattgtgcaactctggaagttacaggtggtttctttgcatag

DBGET integrated database retrieval system