KEGG   Ciona intestinalis (sea squirt): 100185372Help
Entry
100185372         CDS       T01056                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J-A-like
  KO
K03245  translation initiation factor 3 subunit J
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100185372
Ribosome biogenesis [BR:cin03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100185372
Translation factors [BR:cin03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100185372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit ChitinaseA_N CsgF SMC_ScpA
Motif
Other DBs
NCBI-GeneID: 100185372
NCBI-ProteinID: XP_002131389
Ensembl: ENSCING00000020776
UniProt: A0A1W2WI84
Position
14
AA seq 233 aa AA seqDB search
MDDWDSENFEPADVKLNSDKWEGEDEEDVLKDNWDDEEEEKEKEEEKPKVEVKKGGKKYL
QMKLKEKEEEKKREAERRRQEEEEKTPEEKMRDKLLAQKLAEESDMAMTKELFTKEETTE
TSVSFGDYNPRTKADFIEFAELIKTKLTSLEESPHYAFLVETLVNSCTVCLNHEEIKKIS
SSLNALASEKLKQERAKKGTKKTQKAKLGGGMKSTRNDAMEDFSSYNDFDDFM
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggatgattgggatagtgagaactttgaacctgcagacgtaaagttgaacagcgataaa
tgggagggggaagatgaagaagatgtattgaaagataattgggatgatgaagaagaagaa
aaagaaaaagaagaagagaagccgaaggtggaagtgaaaaaagggggaaaaaaatatctc
cagatgaagttgaaagaaaaagaagaagagaaaaaaagagaagctgaaagaagaaggcag
gaagaggaagagaagactccagaggagaagatgagagataaacttctcgctcagaagttg
gcggaggaatctgacatggcgatgacaaaagagttgtttacgaaagaagaaacgacggaa
acttcggtttcatttggggattataaccccaggacgaaagcagattttattgaattcgcc
gaacttataaaaacaaagctcacatccctggaggaatctccacattacgcattcttggtg
gaaaccttggttaattcctgtacggtttgtttaaaccatgaagagattaagaaaatctcc
tcatctttaaatgcattggcatcagaaaagttaaaacaagaaagagcgaaaaagggaacc
aagaaaactcagaaagcgaaacttggtggaggaatgaaaagcacaaggaacgatgcaatg
gaagacttttcatcttataatgactttgacgactttatgtaa

DBGET integrated database retrieval system