KEGG   Ciona intestinalis (sea squirt): 100185793Help
Entry
100185793         CDS       T01056                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00561  Glycerolipid metabolism
cin01100  Metabolic pathways
Module
cin_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100185793
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cin01002]
    100185793
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100185793
Peptidases [BR:cin01002]
 Serine Peptidases
  Family S33
   100185793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Peptidase_S9 PGAP1 Thioesterase Abhydrolase_8 Abhydrolase_5
Motif
Other DBs
NCBI-GeneID: 100185793
NCBI-ProteinID: XP_009861244
Ensembl: ENSCING00000014794
UniProt: A0A1W3JGC7
Position
Un
AA seq 305 aa AA seqDB search
MTDASNHNDEKANVTEHKTSSGKPFSEVDHFINADGNHIFCRYWEPSNTPQHLMMVTHGY
AEHSGRHERLACMFRDMGFFVFAHDHFGHGESEGHKVNVDDYNVYIRDMVQHVNLMKKKF
PGLPIHLYGHSMGGALSLLAAHQNPGLFTDVVLSAPMIAKSPEFSSSIKRFMAEKVAAIF
PYLGVAHLDANAISRDPEQVARYVNDKLNYTGKVQVRMACQLYQIQHAAIQCFPNIDFTF
LVIHGSGDRLCNVEGSKLLHEQAKSTNKTIKIFENGYHELIHDIDGYDQRFLDDIKQWLN
ERIAT
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcttctaaccacaacgatgaaaaagcgaatgtaacagaacacaaaacttca
agtggaaaacccttcagcgaagtggatcattttatcaatgcagatggaaatcatattttt
tgtcgctattgggagccatcaaataccccacaacatttgatgatggtaacccatggttac
gctgaacacagtgggaggcatgagaggttggcttgtatgttcagagatatgggattcttt
gtctttgcacatgatcactttggtcatggagagagtgaaggccacaaagtaaatgttgac
gactacaatgtttacatccgtgatatggtgcaacatgttaatctaatgaagaagaaattc
ccaggcttaccaatccatttatatggacattcaatgggtggtgctctttcattactggca
gcgcatcagaaccctgggctttttactgatgttgttttatcggcaccgatgatagcaaag
agcccagaattttcttcctctattaagagatttatggctgaaaaggttgcagcaattttc
ccttatcttggggttgcacatctggatgcaaacgcaatatctcgtgaccccgaacaggtt
gcaaggtatgtgaatgacaaacttaactacactggcaaagttcaagtaagaatggcttgt
cagttgtaccagatacagcacgcagctattcaatgtttccccaatatagacttcactttc
cttgtaatacatggtagtggggataggttatgcaatgttgagggatccaagttattgcat
gagcaagctaaatcaacaaataaaaccataaagatatttgagaatggttaccatgagtta
atacatgatattgatggttatgaccaacggttcctagatgacataaaacaatggcttaat
gagagaattgcaacgtaa

DBGET integrated database retrieval system