KEGG   Ciona intestinalis (sea squirt): 100186130Help
Entry
100186130         CDS       T01056                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00010  Glycolysis / Gluconeogenesis
cin00562  Inositol phosphate metabolism
cin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100186130
   00562 Inositol phosphate metabolism
    100186130
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100186130
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100186130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100186130
NCBI-ProteinID: XP_002121164
UniProt: A0A1W2W4N5
Position
14
AA seq 464 aa AA seqDB search
MAISAQLLQVCCISFFFIGPYRSTLNSHQTLANDWFKKYLATKTPYASKPEDSLYDQRPW
IASEIPKDYKVLHIDALYRHGTRFPSKQKLLVWWEQLSGLNRTIDNKILAETLSIWNQSF
PNHRHYTLHKTGWIEHENLAANLYKMAPQLFKSILHTNDRQSSLHVLSSHKIRVLASARA
FLSQLLCLVEQGKCERYQPWKVLEDTADVTYSGVEVQVNRSQLRPFDSCSRYEKLMHENE
AGSSEYNKFFLSSHWQALKREISAHFNGYNVADADVLSLYQLCAFDLALYGRNELCANFS
EYFFELLEYASDLKHYYKTGYGFGINYHLACPILEDMLFKLDKAVQAGGSTNGSVVLRFG
HAETLIPFLCLLGLYKDDTPLTAQSFSLHRNARKFRTGTFSPFAGNIALVLYSSHHNEKM
LLSIVLNERVLKLPYADCHYCDYTAFRKLLASRLEGINCNKVCD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggccatttccgctcaattattgcaagtatgctgcatttccttcttctttattggccca
tatcgaagtacattaaatagtcaccagactttggctaatgactggttcaagaagtatttg
gccaccaaaacaccctacgcatccaagccagaagattccctttatgaccaacgcccatgg
attgcgtccgaaattcccaaggactacaaagtgcttcatattgatgcgctttaccgacat
gggaccaggttccctagcaagcagaagttattagtctggtgggagcaattgagcgggctg
aataggaccattgacaacaagatcttggccgaaacgttatcaatatggaatcaatcgttt
ccaaatcaccgccattacactttgcacaagacaggctggattgagcatgaaaatttagcc
gcaaacttgtataagatggcgccacagttatttaagagcattctgcataccaatgaccga
caaagctctctgcatgttctttccagccataagataagagtcctagcgagtgcccgagct
tttctctctcagcttttatgtctagtggaacaagggaagtgcgagaggtatcagccatgg
aaagttctagaagatacggctgatgtgacgtattcaggagtagaggtgcaagtcaaccgg
tcccaactacgcccatttgattcgtgctcacggtatgaaaagcttatgcacgagaacgag
gctggttcttctgaatacaacaaattcttcctttctagccattggcaagcactgaagcga
gaaatatccgctcattttaatggttacaacgtagcagacgcggatgttctatcattatac
cagctatgtgcttttgatctggcgctgtacggacgaaacgagctatgtgcaaactttagt
gaatacttcttcgagctgctagagtacgcctcggacttaaaacactattacaaaaccggc
tacgggtttggcataaattaccacctagcttgccctattttagaagatatgctatttaag
ctggataaggccgtacaagctggcggatccacaaatgggtccgtcgtgctacgattcgga
catgctgagaccttgattccttttctgtgtttgttggggttatacaaggacgatacacca
cttaccgcacagagtttttcattacaccgcaacgcccgaaaatttcggaccggaacattt
agtccatttgctggtaacattgcgcttgtgttgtacagctcgcaccacaatgagaagatg
ttgctttcaatcgtacttaacgagagagtgttaaaattaccatacgccgattgccactac
tgtgactacactgcttttcgtaaattacttgccagccgtttggaaggaatcaattgtaat
aaagtttgcgattaa

DBGET integrated database retrieval system